SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for GSADVT00028011001 from Adineta vaga

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  GSADVT00028011001
Domain Number 1 Region: 84-152
Classification Level Classification E-value
Superfamily AN1-like Zinc finger 0.0000000000000772
Family AN1-like Zinc finger 0.0019
Further Details:      
 
Domain Number 2 Region: 4-47
Classification Level Classification E-value
Superfamily AN1-like Zinc finger 0.000000000693
Family AN1-like Zinc finger 0.0052
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) GSADVT00028011001
Sequence length 225
Comment pep supercontig:AMS_PRJEB1171_v1:HG380873:85834:86876:1 gene:GSADVG00028011001 transcript:GSADVT00028011001 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MELPHVGKHCSVKSCNRLDFLPMKCDSCPAILCKDHIKYDEHQCPSPRRKNIQIPVCPLC
NQAVSSINRDESPDVIISAHIDRDCKSDPAMKKRGKVYSNKCSLTSCKQREAIQVKCDKC
MKTYCLKHRFAEDHKCQGFESTGRTMNLAGAAAIERIKKMNVNNENKPSNSTTMNEDEAL
ALAMKLSLNETSQEDNDYLLAKALQDSEQEEARRKNRNTSIQSKA
Download sequence
Identical sequences GSADVT00028011001

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]