SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for GSADVT00028429001 from Adineta vaga

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  GSADVT00028429001
Domain Number 1 Region: 2896-3052
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 2.69e-48
Family MAM domain 0.00051
Further Details:      
 
Domain Number 2 Region: 3398-3560
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 6.17e-45
Family MAM domain 0.00015
Further Details:      
 
Domain Number 3 Region: 6012-6167
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 4.27e-42
Family MAM domain 0.0016
Further Details:      
 
Domain Number 4 Region: 3978-4139
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.9e-41
Family MAM domain 0.00049
Further Details:      
 
Domain Number 5 Region: 1868-2031
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 2.06e-41
Family MAM domain 0.00094
Further Details:      
 
Domain Number 6 Region: 2554-2716
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.3e-40
Family MAM domain 0.0014
Further Details:      
 
Domain Number 7 Region: 7524-7696
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 2.22e-40
Family MAM domain 0.0017
Further Details:      
 
Domain Number 8 Region: 6680-6842
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 4.91e-40
Family MAM domain 0.00077
Further Details:      
 
Domain Number 9 Region: 282-447
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 9.81e-40
Family MAM domain 0.00055
Further Details:      
 
Domain Number 10 Region: 7753-7912
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.35e-39
Family MAM domain 0.0022
Further Details:      
 
Domain Number 11 Region: 1705-1864
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 7.12e-39
Family MAM domain 0.0088
Further Details:      
 
Domain Number 12 Region: 4879-5046
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 7.28e-39
Family MAM domain 0.001
Further Details:      
 
Domain Number 13 Region: 3056-3214
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 3.64e-38
Family MAM domain 0.0018
Further Details:      
 
Domain Number 14 Region: 4370-4537
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.25e-37
Family MAM domain 0.00085
Further Details:      
 
Domain Number 15 Region: 1169-1330
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 8.39e-37
Family MAM domain 0.00082
Further Details:      
 
Domain Number 16 Region: 5625-5784
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.5e-36
Family MAM domain 0.0012
Further Details:      
 
Domain Number 17 Region: 979-1138
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.9e-36
Family MAM domain 0.0021
Further Details:      
 
Domain Number 18 Region: 450-613
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 3.16e-35
Family MAM domain 0.0017
Further Details:      
 
Domain Number 19 Region: 6337-6496
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 6.65e-35
Family MAM domain 0.0014
Further Details:      
 
Domain Number 20 Region: 2035-2198
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 6.8e-35
Family MAM domain 0.0025
Further Details:      
 
Domain Number 21 Region: 6170-6331
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.31e-34
Family MAM domain 0.00083
Further Details:      
 
Domain Number 22 Region: 4693-4854
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 7.6e-34
Family MAM domain 0.0043
Further Details:      
 
Domain Number 23 Region: 2228-2380
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 2.53e-32
Family MAM domain 0.00076
Further Details:      
 
Domain Number 24 Region: 6890-7050
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 5.22e-32
Family MAM domain 0.0021
Further Details:      
 
Domain Number 25 Region: 2732-2893
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 3.16e-29
Family MAM domain 0.0043
Further Details:      
 
Domain Number 26 Region: 6515-6676
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 2.53e-28
Family MAM domain 0.0071
Further Details:      
 
Domain Number 27 Region: 5842-6003
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 4.11e-28
Family MAM domain 0.0026
Further Details:      
 
Domain Number 28 Region: 5211-5371
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 8.07e-28
Family MAM domain 0.0018
Further Details:      
 
Domain Number 29 Region: 817-976
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.9e-27
Family MAM domain 0.0017
Further Details:      
 
Domain Number 30 Region: 5049-5207
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 9.18e-27
Family MAM domain 0.0046
Further Details:      
 
Domain Number 31 Region: 107-277
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 6.33e-25
Family MAM domain 0.0032
Further Details:      
 
Domain Number 32 Region: 648-812
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 7.28e-25
Family MAM domain 0.012
Further Details:      
 
Domain Number 33 Region: 3775-3931
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.06e-24
Family MAM domain 0.014
Further Details:      
 
Domain Number 34 Region: 1512-1674
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.23e-24
Family MAM domain 0.0065
Further Details:      
 
Domain Number 35 Region: 3563-3733
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 3.8e-24
Family MAM domain 0.0015
Further Details:      
 
Domain Number 36 Region: 4200-4358
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 3.16e-23
Family MAM domain 0.0051
Further Details:      
 
Domain Number 37 Region: 5409-5572
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 6.8e-23
Family MAM domain 0.0055
Further Details:      
 
Domain Number 38 Region: 7106-7263
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.04e-22
Family MAM domain 0.0013
Further Details:      
 
Domain Number 39 Region: 1336-1509
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 4.75e-22
Family MAM domain 0.00079
Further Details:      
 
Domain Number 40 Region: 2387-2549
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 6.17e-20
Family MAM domain 0.00075
Further Details:      
 
Domain Number 41 Region: 3234-3395
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 2.37e-19
Family MAM domain 0.0046
Further Details:      
 
Domain Number 42 Region: 4540-4690
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.74e-17
Family MAM domain 0.013
Further Details:      
 
Domain Number 43 Region: 7318-7475
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 3.64e-16
Family MAM domain 0.019
Further Details:      
 
Domain Number 44 Region: 7965-8132
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 7.6e-16
Family MAM domain 0.008
Further Details:      
 
Domain Number 45 Region: 3937-3974
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000641
Family LDL receptor-like module 0.0016
Further Details:      
 
Domain Number 46 Region: 7058-7099
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000131
Family LDL receptor-like module 0.0014
Further Details:      
 
Domain Number 47 Region: 7285-7318
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000393
Family LDL receptor-like module 0.0028
Further Details:      
 
Domain Number 48 Region: 7925-7961
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000916
Family LDL receptor-like module 0.0023
Further Details:      
 
Domain Number 49 Region: 5583-5621
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000367
Family LDL receptor-like module 0.0024
Further Details:      
 
Domain Number 50 Region: 5371-5410
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000393
Family LDL receptor-like module 0.0028
Further Details:      
 
Domain Number 51 Region: 3744-3775
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000011
Family LDL receptor-like module 0.0028
Further Details:      
 
Domain Number 52 Region: 7714-7754
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000017
Family LDL receptor-like module 0.0036
Further Details:      
 
Domain Number 53 Region: 5805-5842
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000838
Family LDL receptor-like module 0.0037
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) GSADVT00028429001
Sequence length 8294
Comment pep supercontig:AMS_PRJEB1171_v1:HG380876:141460:172848:-1 gene:GSADVG00028429001 transcript:GSADVT00028429001 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGDKSNKLSVFVDKQYIWRSRLIQGQSRTQVQLNISSQITIGSSRTATLIAFDGQLQKNA
QIQVEDIMINHQACPSITKRSISKRSTQTMSASRSRTIRSVTSKAVAGYDCTFEQDYCGW
TQGQNVTIPWFREQAASNSLAGVVGPLYDHTYGNATGYYVTARLEIPVINFNDIDISELV
SPRLPDNIASPMCVDWWYMMHGTDDTEFNLNFVVNENFTSAKSAWRRSGDQGRHWQHGQI
QINPGDQITRVVYEVVALWSIRSEVSLDDLTLVDGPCIQPDFYSIDCTFEEEHICGYSSD
PSGQFAWTRGQGTTPSSQTGANQDHTLGTALGHFMYIESSSPQRPGQKARLLSVVEQPEK
GRCLEFWYHMYGRSVGQLNVYTGTNTSANSTMTLLWSRGANVGDVWRKAHVSTEYTTPFR
VIFEGVIGNGFEGDISIDDIKRLSVSCQEPNNCDFEDDTFCGWENVKTDQFDWEITNGPS
SASLASGPLYDHTLGTSAGSYAYIDTNKNRKTNDTAILISQSMANAGSNGMCLEFFYHMF
GPGIGRLTAYLQLEGFQPLAMWTLEGEQDDDWFQGKVGFAVSSDHSVLIEARVTLNNHGD
IGLDDISIKNGYCNTLPPYAIPQDGLSTASTSPTTKVLVKEMIFFHSYFDCDFESDKCPL
WSITAKPELTWTRVQGATASQDDQHNPLYDHTGNQVQGYYLLLTPTKSTPFPDTNITSQY
RSTQMSNNRQCLEFWYFMYGSHVGSLNVEKLSNSFSQLRWTTFGGKGYEWYHAQVNLQSS
TSNPATFSVCIWSGSNRGSIAIDDITLLNGTCRTSTDQCDFDSDDSICGFQYDPTGQFNW
IRGLASVVQAGVNPNNDHTTLTDEGYYMVAEGKNRNANDRARLLTPIQDRTSGSCLHFWY
FHHASTKQMNLNVFLASGGPILWSHDGSLENRWLYAQININSPSQSWQAVFEADVLTQNP
DASASIDDVSITRGLCPKPGDCTFESDLCGWTNDDIDVEMDWLVGQGIHSSGTGPQYDHT
TNTAQGKYLMIETSWPTQQGDRARLKSVVFDSTNGDARCFRFWYHMYGDSIGTLNVYLFN
SSFTRIWSLSGNRGNMWYEGQVSYVSSVQHQILVEGIAGKDFLGDISIDDFTFTTSNCSI
RPLHDAVPTIATTMPPTTTTTRTTVAPQSPWDCNFEQGVLCSTWSHDVTADFRWELKQGQ
TFSANTGPSVDHTFGTPQGWYIYMEASYPQQPDQRCRIVSEEISGQKCIQFWYHMYGMDV
DTLNVYIKMNGQLNKPVWTRSRNQGDKWLKGQYAIFPPANTKFQIVFEGIVGRFHLGDIG
LDDIVVYNSCPNDDRICTFEDPTICNYANDATIQYNWLRTTADDPLMNGIKPNTDHTDGT
SNGAYMIVDVTQSSTTVTNQRARLMSQTIIPNGEQCIEFWYYSDAQAISTSSKLNIFVRP
STVTSNSSDYLIWSKTILRERQWRISQQRVPHGLVLSPYQVIFEAVVFKSGSDVPVIAID
DVFIRDRACLEPGDCDFENGMCTWRNMLLFGNATWMIGSGLSKPPYNGPQNDHTLGNDKG
QYLLLSSAFTNQQSVVAVILSETFAPTSRAGRCLTFWYFMRGSQLGRVDVNITTDKDTSM
IWSFGTVDQGDSWLFASVGYYSDEDHAIAIEGSVTAQMQGYYAIDDIDIRDSYCGTNPTN
AAVSVLTTPATVTRPTTAYQIPSIYDCTFEVDFCSWTHRSDAALNWTRNQGSTSTFETGP
QFDVTTHTDQGWYIYLETSSPVILNDTARLQSPSIPGSTPKCFEFWYHMHGPDINRLDII
AIDSSNQETTVWSREGTQGNVWRLGKVKLNDITDEYSIIIQGVAGNSYQGDIALDDLILI
DGNCPSDLPLECDFDDAGICGFTHDITEKHQWLRHKGATPGSLSGPSIDHTTQSVNGYYM
YTPSASSIKAGEKARLMSPWMNNTNGQCLSFWYHSYGVDVGALTVYKRVASSDNLYPIWK
VNYNFGDIWNAAEITIRYTNEPYAIVFESEYGIGYFGDLAIDDVLIKNGACQVIGSCSFE
SIDFCTWHNLRAPLDEFDWLIGHGQTDSAFTGPSVDHTYNDQFGFYAFIEASHPRVPNDR
AILESTILMPTSTIGSCFSFWYHMYGSIGALNIYINGVKSLEPKWVWTQKGNKGDQWLNG
QVTIRSSSYLRLRIEGVIGDSFQGDAAIDDLRIFENPCVVTPADADPELFPPTTTTTTVP
TTTNPLGPYDCTFETDSCNGWENMANNRFNWTRVQASTVPAPSIDHTTHTGQGYFMQANL
GQRQKNDFARLKTPLLSNLQCMTFYYHLYGHGGTLNLYMALGNNLGIPIWTRVGSQGDVW
RFGRITATKDNANIVFEALAGTNAIGGVSIDDVIFTSGICRESAAIGESCTFTDVSQCGF
TQNTTSSTLQWKTYSGGDEVLRTTPIPYDHTTGTNRGSYVYIDLENQGENLNGRLYSPMY
ASTMNATYCVEFYYVLVGSNTSFNVYTESNIGTKRTIFTRSYDHGLAWIKGEASVTSPSE
FRIVFETITGFFRQGFVALDDYTYKSGECGFRQNECSFDDGSLCSWTNAADNQFDWLAQK
GTTVTSSTGPNGDHTTGNGYYLYIETSTPALLGWKARLESEVYLDNGPRCFSFWYHMYGR
DIGRLSVYLRSIGTNNFTSESLVWVLAGPQENNWKHGFAPIQPNGRYQIVIEGVRGKSFE
GDIAIDDIGVITSDSCTLQPVDADPIQVSQQAISCGFENNFCQWQHDPTGKFNWTRHTES
TPSVDTGPSTGADNTPYYIYIETSYPQAQGDRAGLISPVISKAKSDMCFQFYFHMWGAHI
GSLQISALQNTPTGQQQILLWERNETQAKEWRVAYLNLRDIPYDFALKIDGFVGNGWEGD
IGVDELFLLDGECPPSVWCDFETSFCGWTNDTTGDFYWTRARKATDSPSTGPSTDHTTGT
DRGYYLYIETSSPQKPGDKARIVSPMYAASSSVCLKFHYHMYGASIGTLNVLMANTKQLL
WTKSGNLGNRWRYGHVTVRSNSPYQVAFEGIAGSSFQGDIAIDDIMIANGPCEDEGSCTF
EDGTFCGFYNTKEEDNFDWTLNQGETFSENTGPIIDHTTGTSAGYYAYIESSLPQKLGDK
AWLVSEVVESPKGACLDFWYHMKGDTTGNLTVLHRIMDKQPTILWSKEGDQGDLWLNAKV
DLPVTNDHYDFIFEGVVGDGHESDIALDDISLAQAGTCAFLASTTQAPVTPQTAAYECDF
EDGSFCDWQVETDQKWIVSSGQTAVYGKAPLIDHTRQNIHGKYAYVPIEGNGGPVYFATL
GIRSLPRGVTFCLDFWYQSFISSTTMLNVYMQNGTSKADFLWSRPGTTVRDQWTHTSINL
GTIHGAAHITISAVVVPSSTGYVALDDLKILNGVCPSPRVCDFEDASICGYQNDATADFS
WSRHRGSTTSSVTGATNDHTYGTGIGYYMYIETSSPQKQGDKARLITPEYKVAAGGSCLQ
FFYHMWGASTGALNVYLKVGQTLEGRPLWALSGDQGNLWRPARATIKTTGKFQVVFEGVV
GPGFTGDISIDDVSISSGPCSPPGSCTFEQDLCAWTPSDGKNDFDWYRLSSKQIGLLYNN
SAYPSTDTTINNAYGHFLWAASDFRSNRANQSSSLYSEILLAYQYQGGACITFSYFLANS
ATLNVYSRARPANQNSTLLWTKSDDHYDYWLQEEIDVPVIASDFEIFFEGIFNPSVSTSS
VALDDLHIHSTPCSQIESTPSPSIPFDCGDGTTIPQSSVCNFITDCDNGHDEQDCADCTF
EQGTCRWLDISIGPFAWTRDQGNNVAPLHLGPVVDHTTHTGRGFYMYVKQSDGLFWDDAT
FELQQVLQQSSAGCVLEFWHHMLDHQFLSVHLLEGDTSIEIWEEDHAHGDQWEPVTIPLG
RITRPWRLQFLAEKSWGDGTVAIDDVRLYNCRFPPARPNCTDNQFRCTRGACVSLDRVCD
FTDDCGDNSDELNCQNNIMCSFEEPTGMCDWTQDEDNDLDWELGQGETESYKTGPKRDHT
LGLPSGHFIFLEASYPANEGERARVASPVINSTGFSCEFRFYWHMYGEHIGALNVYTRST
YGGEMSKIWSKKGEVGDYWTRTDLPVILGKPFQIVLEAIVGDGYAGDIAIDDTSFTSGCV
LANVDLVTVTTPIPSTTTPNPCAATGEFMCVENGQCIDKAKVCDFKVDCPQPGGSDEAEC
GTCTFDNNNGTLCGWKDYSYANLQWKLTTGKTDLGPSSDHTTGSGFYVSVPASDSFSFAS
MRTPTIGPTGVECQLKFWYYLDYDKSTASTRIAVYIRRESNNFTTFSYIATVDEPTGAQW
KQATVDIGGRSERISIEIDGSPGEFNAVAIDDIEFYNCQVSAPPQLGLLIDCTFEHGWCN
FFHDESADFEWERSNTATITSNTGPGFDHTTGSGYYIFIESSWPRVPNDRARLLSGYQNP
TSTPRCLTFWYHMFGADIGTLNVYLQTLTTTSSSVSSALVWTKSRTQGNIWRRATQTLRN
LNTTNMYGWRLAFEGVVDKSYQGDIALDDIFVSQSECPASRTCNFELDLCDFQSTPENGW
IRQQATNLSNFINEDHTSGTSLGYFAMATQDNAKLRSKQYPNVGDECLKFWYFVNGPDGA
TGILSVAKQNSGSSIESTLWSNDIYVNEWRYEQVIINGLSDPFYYMFQASKSSPDVVIGV
DDVILTLGSCSPPINCDFEGPDLCSWVQMKDNTFDWLLQSGSTDSFGTGPLVDHTTNSAQ
GHYIYIETSSPTKPNDTARIISEHLLIGQGCFSLWYHMHGEDIGSLVIYTSTKANPKTEV
NRINGEQGNLWKKLNTDIAVTLQNREWVRIIVEGIAGPSFQGDIAVDDITWSPNATCQST
DTTAASTTPSVPTTYPPTIYDCDFECNCTCQWKHDETLPFKWIIRKGSTSSIDTGPEADH
TTGSRQGHFIYIETSSPAQFNDTARLISPDLIVVNDDQCFRFYYHMFGSDVYRLNVYARI
NGNLGKALWQKEGNQGNQWLFGRIQLRGNVEQAVGQPFQLVLEGIVGTGFRGDISLDDLA
VNNGPCPISTVCDFESSDLCGYVNDPTNTIDWIRHQAGTDASIPATDVSYGSSHGHFMFL
KGNDATKSLSGRFVTPSYPDTSGSCIRWYMLLENTPTLRVRTFAFGSLNPNILYTIHGTQ
GTQWKAAQITVRSGSPYQVVFEGLLNNTNSMLDSIALDDVSIRSGACDPLGSCDFEQGIC
GYQYMKADFDWKRTSYNVETYSAPQFDHTTNTRAGFYLWIDRRQTTQGKKARIESELIPV
GIQCVSFWYYMNNTVGAQLNVYIRDPRSDVYSTIWSTDTIHGSFWVLQEVTVRPNMTVNG
TNTFTIVYEGVIGSKIGDLAIDDLSIRSGTCQSTTPPQNMYKCLDGTLIPKNKVCDFIVD
CKGGDDERSCGNCTFEGTANQLCGWSDISKGTLKWTRGSNETLLGAGQGPPFDHTTYKSD
GNYIYLTQGNGTTPDAPARFITPVLREASTTCLLEFWIYLTGTSASQLTVTLLTGNQIER
ATLQRFHYKSMTNWTKVNIEIGRVDVPFQIAMDSRRTSTYGWVAFDDTKILHCHLPPIVN
ITKCQEADRYYCSRGSCIAKSRICDMTDDCGDHSDESTRLCASYQTCTFDISFCDWKHDN
TTEFKWELVRGVSPSDDTGPNRDHTTGYATGQYALIEASYPQTPGQKARLISRPFEPKIA
GCRLVFYYHMFGIDMGELNIYVRYFSNGPLDKVFGVSGERGNAWIRHELKLNYTTPFQVL
IEGVVGSSFLSDIGLDDTIFSPECEPSPLSDLPETTTIITTTPKVCPVADQVHCPGTDIC
IDKDKICDFTADCPDASDEDRCGPCNFEKDDCGWEDVSWTYYTWSRVQASDAVSISSHAP
AYDHTLNNAAGWYMHVAGDMGDFTDLAELRSPALPVSSPECQMVFYYWLVGNSTGTLEVY
SSSNKSALWRQTSAPANRWNRATVNVGANRAGWRIYFELEPNLDFFGTWTDDVAIDDISF
TKCSTNRSRHILDCDFETDFCSWETKGLADFEWTRISSQTPSVATGPPGDHTTGTGSYVF
IESSLPQKPGDRAWLRSPMIPPALTNCLNFYYHMFGADIRTLNVMIQTPSSNLTVFTRNG
PQGNIWRLGQVEYHSTQSYQVVFEGIVGKSFDGDIALDDIELNVGECPTTIECTFEHGLC
AGWEHDPEGDFNWSRGRNGSTPSGTPTIDHTFSSVIGHFMYINATGHLQGDTAYLMSPSY
KGSQPRCLRLWYHLFGADQGILQIQQKPEIGRAKTLWTRLNNQDNIWRQARINIPPLLGM
STYKILIAGIVGAKPTGDLAIDDISNSEGECPGSEVCTFQEDFCTWANGENGVVDDFDWL
RNSGETPSYGTGPSVDHTFGTPEGMYIYIEASDAFNTSHKAWLISEHYDAGPHCLVFWYH
LYGPDIGTLNVYSRIGTSQPQLEWSLNGDHGDQWRMGAVNVNMAAEFYFIIEGVHGGNYR
GDMALDDILVMTGSHCTIPTTTTTRAPVTTIGGHTPLSCNFENDTCKWTHDLTVSGKWSR
HQGQPSDFHTGPHYDHTLQTQDGWYLDTSDLKSNQTARLISTMTSIPTRGICFRFWYRAY
GSRQGKLNLLQKASNEQNVTLVYSLRPNLDIDWREAIIYRETYGNYQFILEAIVGFVVAD
SDNIAIDDIVTKEGPCPVQRFCDFESQDICGYTYDPSGTFNWTRNKGKTDSWYTGPPYDH
TTFTAEGYYMFIETSYPRQPGDVARLISPTFPASKEYNCLQFYYHQLGADVDTLNVYKRD
VGGSLVPSKLFTAKGDRFNEWHVQEINIVAPRPYNIIFEGIVGKSYEGDIAIDDILMKER
ACPEVGNSCPVLPSNCSVRCDTITGTQQCIPTSQVCDFNKDCLNGADESACGYDCTFERD
QCKYTDPSAGLYKWRRQRAGLNTGGTSSSPPIDHTTFSANGYYMIVSTNNGTIDDQAHLI
SPILQQSSSTCEVAFYYHMSGVNVGRLEVLLIEGLEKSRLWSIEGNQGDRWRKAVVKVGR
LYRPFRIRFDARKTATTLADITIDDVEWIGCNLPIINNETATCDSTQFQCKRGGCIDQSR
VCDYSDDCGDNSDEEKTLCTRPTVAPGCNFETDLCKFLNEYNAELKFERARAFQLVDEYA
PERDHTLNNLAGSFVYVNTIGQDVGRSGRLKSSRIIPTNGCKVRFYYYMNSATSAGELTF
MIRNLTAGQTTYLWSTSKVLGDHWERQEVVIPTGPKYELLIEVRSLGGGGYIALDDISFS
SQCTHTDQYLDYGTTTKPTGTSTRPVCAFQCKDGTCIAKEKRCNFVADCSQGEDEMDCGQ
CDFETSTCGWKDESTGFYIWARRNASSISLMPGDLTTNKTSGFVMNIAGGAGSFAGGSRL
ESERIASTLASCHVIFGLYRNRDKDGTLSLYLEDDNQYSTRLWTDPRTTIGRQWSLVRVS
IGRRRTGFRLVFISTHGGSTISSDISIDDFKFEDCGSQGPIHCESYPDPFNCSNGNCIHQ
DNLCDYSDDCGDSTDESVCDNYVAMCDFENHADPFCSWSHDTDADFRWQRVRGDQINNNN
WYDDFWQIYGPDRDHTLGTSKGHLLYLETSSPRKPNDTARVISPVFAPTTSGNCHFRFWY
HMYGYDIGALNIYTRSNVGGKLNLLWSQTGEKGDEWLRRKLVLNSAQPFQVLIEGVRGKG
YEGDIGVDDISFTPSCTLQSQSTLPTTVPPVTGTPPCNATHSQCLTTTSQCIPNDAFCNF
YIDCKDQTDELACPLACNFEQKSLCQWTNDKKQKLQWDFGSGNTASSDTGPSYDHTTHSI
NGTYIYLETSTGFTGDSARLISPLYRKSSKTCMFTFWYHMFGATIDTLNIHIRAGGMDTL
IWSLKGSQGKDWLQGIAYLPTCASQFNIIVEGIRGTSFTGDIALDDFRFEQCYEEPVVTP
TCAAGDSTQFMCQSRHCVPQTSKCDYELDCCDGSDEEDYVCYDYHRCDFEQDSCSWETTS
GSELIWERYRTNALLYQQRPPYDHTTRSHLGHFYLLRLNATTPRDSFAAISTYLAPTVDQ
GCTMRFWIYFKSSYNGQLLVNYRYEIGGDMKSLAISSYTSCPTNSTRCSWQRIDVPLSAV
LISATEIMIGVKTGADRDAIMAIDDITFTPQCSKYNGTIPTKPTPTPYTGSSTTTTTTTP
GSTTTTTYTGPSTTSTVTTTTTPSECAQYTCYNHGICKPSPTEVGKPMCECKPGFTGPQC
ENKEPPKKKSNVGAIVGGIFGAIAAIALVVLGYIFVLPRIRAARDRASLPLMGAQALGPI
TNPAYSETAASSDT
Download sequence
Identical sequences GSADVT00028429001

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]