SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for GSADVT00029076001 from Adineta vaga

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  GSADVT00029076001
Domain Number 1 Region: 171-206
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000017
Family LDL receptor-like module 0.001
Further Details:      
 
Domain Number 2 Region: 80-144
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000467
Family I set domains 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) GSADVT00029076001
Sequence length 323
Comment pep supercontig:AMS_PRJEB1171_v1:HG380881:69731:71325:-1 gene:GSADVG00029076001 transcript:GSADVT00029076001 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLKARITFDDRRKIGKYTCTAYDINGIIDSATLTIQEVSDSHGTQTADPDAQVSACFLAP
DSTGFGNDGIINLIITAPDMEEGDFVELQCTGAALEDAESLKWYFNDQRIYNVYPFHQNG
TSLYIHPITQTYLGRYRCSTRLSIHRDGFIDLKFKNPVSTPSVTVQEERNQCNADQATCH
NGQCIPRAFLCDGDNDCGDNSDEECELSTTTVLSTTTSEPEIVSFCQITWIRSGDRYQPE
APHSMRVLTELKRLSFRVHSLSSSASTDGITVLDYLCEHTNEGMNGNTVQDALRKVIQDS
LRSTSSRSFQSFDKSITLKWTCG
Download sequence
Identical sequences GSADVT00029076001

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]