SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for GSADVT00029252001 from Adineta vaga

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  GSADVT00029252001
Domain Number 1 Region: 704-801
Classification Level Classification E-value
Superfamily Immunoglobulin 6.27e-16
Family I set domains 0.011
Further Details:      
 
Domain Number 2 Region: 1654-1723
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000000000282
Family V set domains (antibody variable domain-like) 0.045
Further Details:      
 
Domain Number 3 Region: 489-571
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000000000284
Family I set domains 0.025
Further Details:      
 
Domain Number 4 Region: 661-709
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000327
Family LDL receptor-like module 0.0014
Further Details:      
 
Domain Number 5 Region: 570-605
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000707
Family LDL receptor-like module 0.0015
Further Details:      
 
Domain Number 6 Region: 1438-1528
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000000000754
Family I set domains 0.035
Further Details:      
 
Domain Number 7 Region: 823-865
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000753
Family Laminin-type module 0.016
Further Details:      
 
Domain Number 8 Region: 1344-1426
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000000154
Family I set domains 0.047
Further Details:      
 
Domain Number 9 Region: 260-351
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000000328
Family V set domains (antibody variable domain-like) 0.033
Further Details:      
 
Domain Number 10 Region: 612-654
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000563
Family LDL receptor-like module 0.00084
Further Details:      
 
Domain Number 11 Region: 1712-1723,1759-1813
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000107
Family I set domains 0.061
Further Details:      
 
Domain Number 12 Region: 1541-1626
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000264
Family I set domains 0.033
Further Details:      
 
Domain Number 13 Region: 391-448
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000559
Family I set domains 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) GSADVT00029252001
Sequence length 1866
Comment pep supercontig:AMS_PRJEB1171_v1:HG380882:213332:222799:1 gene:GSADVG00029252001 transcript:GSADVT00029252001 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKVSFTSFIDCFMYRFPCAEGTNLCKDDNETCATYCNGNPECADGSDELDCIEPAATGIV
LDDTTVILPKGTTATITAEVATTVATETIEPAATGIVIDGTTIGTATIETVTVDANSTDE
ATDGKATSVNNNLETSTILIVDNGTDIFTTVLPGNGQTTEDDNATAVINNGTTSLDSITT
FESITIDSNLTTIADNETVTDVGIDVTTISLNDTATGNDTLWTTTIDALDIDGNVTQSNV
TEEDTTPTPVQPGSADRVELRVVVSPELLQVQRGQTYEITCTVYGADASTAIYWIQEEPE
RRYALTNPAETNDKQVTISQVALRARITIDDTSKIGKYTCMAQDAVGNSGSAILTMQEGR
YVPSPDGPGRAPKPGANGGYLRIIAPDMADGDYVEIQCDGASPEDEGGIQWFFNNRLIND
EQPLYPRGKTLHIRPISRPYLGNYRCSIPGSSYADANSVLTFGGPIPTPGGPFYGGGFTV
TVDIAQGQPHEGAQIILRCRTSEQANSYRWTFASNRGTVDRGYSDQLIIPRASSQDSGVY
TCEAISASGQSASGSTNLQITYAPSQPVSGRCSIDEATCRNGRCIPRAYLFDGKNDCGDN
SDEAGPSGSGDQCQPNEIHCTNADRGRKCVQKFWMCDGDRDCDDGSDEDQRYCELLPRQR
HCKPSEFHCGGPNATSPNPVCIPRSFQCDGYNDCPDRSDEIGCVKPTVVAPPQRQIQVNV
GQTLTIQCTARGSPAPYINWRLNWGHVCNDGSDNGRCTMLQAIDTNDPNFVTGTLTVRNV
VIADAGAYSCEALNNQGFIFATPDAIVDVIIDPNGRSPPTQQCNCNGHSSHCSSDGRCLN
CQHNTAGFNCEFCAPGYQGDARRGTIYDCVPSTGVPEPSLGCDPSGTHMERGGRCICKYN
VEGDRCNQCKRSHFYLNPTTPNGCLPCFCSGVSTDCTSSDWRRQANALPLNNWNVIPKNF
ATDRYEAGDRIQQLHGGRELAIDQNSLGRPANDVLYWKAPQKALGDLVALYDGNIDIHFT
NDGNDKEAPSNDEFIWLRGNNIDLVHKLPQSQRFKANTNATYSVPCNERTFTRKDGTYID
RENILMALSDLDTFLVKINPIGGRRTAVLRGVTLNVAAREGYADTAPTVEACRCPANYTG
SSCEKCAEGYGRPHPLVGIYLGQCWSCRSLCHDRSDRCDRETGKCFDCQGNSEGDRCERC
RGGYVLDARINQCVREDQYQPYPPQPSYGPGSRGSYYVDHRPYDAYGTTPLSIVLDGNQA
EQRIPLQVLNAQPQSVVWGRTDGSPLPIGVIQEGNDLVFRNPSTEQGGNYIATITFPDGH
IERVAAYLDYRPGQVRPTSPGYGQPAFSPPSPLIIAEGSSQTVQPQGGYYRVYWRRGDGQ
GLPSGIYQDGNSLQITGARPDFSGTYYCELHDSVGTPITVPYEIRVEARDRAPAGVDGPP
KIRIEPRTITLKEGQRMIVQYTVGSNDPIEVIWNKLTVHGNQPIPSLFTVEPNRLILHRA
TLDASGTYQVIVRNSHGEDRQELTIIVEPRHGRGQGHPAAVAPQVSFSESNYEVGYGEII
DIRPNLYGDSGSTITWAKDGSTYLPDGVSAREDGTLHVEGQSNYIDGRYTLDVVNSYGRA
SAPVYIRWKGSQGQYGGYGGSNEGSRSYVDVRFQPRDEQSHQIGRDIYLQCTVHGSVEQP
YEYVFTKDGRTLENNVEVHPNGLVTIRNAQANDAGRYRCEVTFPRAPEVGAQENSYDLRL
DGGSAANYDQGGDYQQQQGIPIDVTVEPTEATVGRGEKVTFTCNVKGTQQYTVTWGKYAH
DTSLPNYARQQGNSVIVAPTDDATSEQMYLQCSVNVPGQPQPYLAYAPVSIRGNGEVRKK
KKKRRS
Download sequence
Identical sequences GSADVT00029252001

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]