SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for GSADVT00030591001 from Adineta vaga

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  GSADVT00030591001
Domain Number 1 Region: 1052-1352
Classification Level Classification E-value
Superfamily Family A G protein-coupled receptor-like 0.000000000000101
Family Rhodopsin-like 0.022
Further Details:      
 
Domain Number 2 Region: 795-839
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000128
Family EGF-type module 0.0098
Further Details:      
 
Domain Number 3 Region: 3-44
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000166
Family LDL receptor-like module 0.0022
Further Details:      
 
Domain Number 4 Region: 726-761
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000469
Family EGF-type module 0.03
Further Details:      
 
Domain Number 5 Region: 50-99
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000619
Family LDL receptor-like module 0.0011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) GSADVT00030591001
Sequence length 1363
Comment pep supercontig:AMS_PRJEB1171_v1:HG380893:59571:63968:1 gene:GSADVG00030591001 transcript:GSADVT00030591001 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSTITCYRFLFECDRGPWALCLDWREVCDGKADCMSGEDEQWCDILEMTKCADDEYRCHY
GGQCIPLTFVRDDNLDVDCLDGSDESAENLRHIPLSNSACGNSFSFRCQERTSRYPLAFS
YKQVILAMFTSFDHIKNVNCREAFRYYTLVGNTHDPNIYFEGNWSRNCEFLANHCSDEWL
TLPAKPVMYDYFQFIYMTNRSVDEFKRNVAPDFVCFDAQKCPSLASTIHRIDIIDGLTCC
HISNLTENIETQHFHFMNILFARINRQCSTTDIEVSCENSSYFHCNVSLKCISYHRVGNG
FRDCDYNEDELFPACQLNDSNRLKCISHETNCLLPVALKYGNRNCPKTGNERLMNRFAFN
KSVPFAALCDGMVLHVSLLNDGNENDETNCELWPCNNPYLRCNGVWNCLNGIDELNCPNT
NCSFNAFQCTNKASSLTYCLPLTYMFYKRIDNCTEAEYIPEVYFYNETNDISKDYYSFNR
SKCISGNSICNHHLETVDEQDKECLSQLDKSNTYLCTIDYESTAFVIDYIDFLITTGLGY
FPPVSSTIPSIQSITKINEDKKKIIPEIDIALRWYCHQGVVVLFGANQSKKCLCPPNYFG
SQCQWQNQRISLTLHLKTQSIISTTVIFKLIIILIDEQGKIAPNYEQIIYIPSRHCTSKY
NIYLIYPHRPKYSSTNYSIHIDLFDKITLEYWTSWYIPIPFQFLPVNRISTVLIIPKTPQ
NNPCSFPCGEHGRCMEYTNRKSSYFCQCDEGYSGSFCNITHECQCSNDSLCLAPSICVCP
LNKFGSRCYLERTLCQPRNNPCQHDGICIPTDDRIDLYSFICFCKEGYFGERCQFKSNQI
DIHIDETILAISSSFFIHYITAHERLAQHERTTILKKVAFNQNSITIYVPQSFNILFVEI
PKNDYYLSIIREKFIPLEHIHAQVLSKQRCIFVLHLVNDTIRHYEYLRRLKYYPLLCRQH
LQLMCFYDEYNMCICDSDRFSNCFESDHTLKHDCHEKDLCQHGGQCFLDNEICPTTFICN
CDDCYYGTRCELSTKGFIFLLDPILGYHIKPNVSLNQQPFIVKLSIVIITIMLLLGLSSG
SLCVIIFHMKTSREVGCGYYLLASSISSICLIIVLTIKFIHLLLSQMSLITNRSMLFVGC
ISFEIILKVFLASSEWLNACVAIERTISAIQGVSFNKNKSKTRAKIMIFVVFILTTFTYI
HDPFHRQLIDDLDGNQKRIWCFSNYSRSLTIYNSFIILFHFLIPFAINLISALLLILVVA
HRRFKAESKQTFKQGLKLQFQQHKHIFIAPCMLILISLPRLIISFTSGCMRSAREPWLHL
IGYFLSFIPTMLTFFVFVLPSSVYKSKFDTIIAKTMKRFHLTP
Download sequence
Identical sequences GSADVT00030591001

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]