SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for GSADVT00031723001 from Adineta vaga

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  GSADVT00031723001
Domain Number 1 Region: 1263-1568
Classification Level Classification E-value
Superfamily Family A G protein-coupled receptor-like 0.00000000000302
Family Rhodopsin-like 0.015
Further Details:      
 
Domain Number 2 Region: 990-1035
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000321
Family EGF-type module 0.044
Further Details:      
 
Domain Number 3 Region: 214-250
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000698
Family LDL receptor-like module 0.0024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) GSADVT00031723001
Sequence length 1576
Comment pep supercontig:AMS_PRJEB1171_v1:HG380902:308576:313646:-1 gene:GSADVG00031723001 transcript:GSADVT00031723001 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKIFYRYILVILIFSSNFLYINGEYYLYDDDCLDYNVTNDAQLLTGYTVNEQQFVPFCRN
DNFEDDQDDMSDREISKLTFDQLSKRDISSLQLFEWSVHLDLVEEYQSFLENRTDKKMIS
SNFFIYNCSIKLKFGQHCQYSFNSHASFDTIVKNIFKTYIDIPSNGIGTCYIHLNCKRND
MIWCLDWREVCDGKADCWPNHVDEYFCEKLEQNDCAPNEYRCFNGQCIPDVFLLDRTAVP
DCLDSTDEEANIVQPFSSICDNNNRNPSFRCSDVSCRHWTESISQYGRELCEPMKCRTKL
EEQINRNILLPIFNGHITKNCWITMICLLKMQYLCKSICFEPRNSCTERIIKYCWPLFEF
PASSIGWSDLHFVYGWNRTKHICYNEQRCSTSQTNFRFKKISDPSIILSCESSSIDNPTN
GWLRQVRSSQRHTYGQCSFAIDVNDNFCSEKTQFRCGRKCISKYRIGDRRFDCSDLSDEI
LYKDTCNLNLKYRVRCKSDDPDSKGIVCIPSISISTMGENNCGQNGKLPHFPTLCNGYVE
HTEYRNQRTETDEDNCEAWLCDNQYTRCNGIWNCPNGEDENNCFHEICNGSIGQPCLLLY
TAQFICLPAANISDGIVDCIGATDEQQACRNILNGQTGYRCLTDRSDNKQFSNETRICTD
GLQACFESSICRIDEINWSPLCADEYYWYFQCAYFWKSDRRLTKDNIMCSLDDDAIFNPN
GNYHRPEFSLDEYNVVLFTDSIDGLLPIISKSEFTSLLNLNNQEKSLIQFQCYGGIPIYL
RNQIKCLCPPYLYGSQCQYQNQRVSITLQISAPEWRIPFIFIIYLIDETYDIINSYYQIR
YLSIRDCNTKFNFHLIYLTKPKFINRTYSIRIDVFEMNSLKYRASWFYPILFPILPVYRL
PIHLTVPLVSLSPKRSCRRKCSIDRGECISYTNTGEFFCRCKPNWTGSMCTIPYQCNCSP
DSICVGIWKNKSICVCPTYKFGRRCYLKNNLCKRSNAEKCRNRGQCIPGNMKFPESSSTF
CSCPYGFHGDLCELTDTRIDISILLPPIQDFLLIHFITINSHMNSNPYIPILKYGPHERA
TTFKKIPFDKNIVSIYWQYPFHMIFIEYNYYLYMIFNQTNYNRISYLKVNLQSHHQCRTI
REFFNQTIMNYSLLRRVKYYHLPCQNDFDLNCFHDEEDYICLCTFDRRANCFTFDHKIKF
SCQQLSYCQNGGQCFQNNLKCPSAALCSCPKCYLGTRCQISTRGFNLPLDVILGYRIRPG
YSFSNQPISLQLSGIITLIMFIFGLIQGSFSCITFQEKELQKFGIGIYLFTAAILSIVTI
SIFTLKYILFLITQILMMTNRQFLFAQCIIIDFLLKISVQIGDWLYACVAIERLLTVIKD
INFNRKQSRKIAKWIIFIVCLIIIINSIHEPFYRRLVYDEDERRTWCILQQTKSLDLFTS
ISTVFHILCPFIINIISALGILLMRIKHRLHLDKHRRIYHHIHNQFHKHKYLIISPIGLI
LLVSPRIILAFQLECMKSARESITLFLIGYFISFLPCLSLFIIFIVPSEKYRQAFKIAIH
TRWNTFYRRIRCQRES
Download sequence
Identical sequences GSADVT00031723001

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]