SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for GSADVT00032126001 from Adineta vaga

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  GSADVT00032126001
Domain Number 1 Region: 938-1242
Classification Level Classification E-value
Superfamily Family A G protein-coupled receptor-like 0.00000000000146
Family Rhodopsin-like 0.016
Further Details:      
 
Domain Number 2 Region: 227-263
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000982
Family LDL receptor-like module 0.0014
Further Details:      
 
Domain Number 3 Region: 679-724
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000984
Family EGF-type module 0.0098
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) GSADVT00032126001
Sequence length 1245
Comment pep supercontig:AMS_PRJEB1171_v1:HG380906:230854:235518:1 gene:GSADVG00032126001 transcript:GSADVT00032126001 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MNVIMILFLLIIKIRLIHSSFRLYNTINKQNNHLDSDCIYFHHTWSNSIEKKFSYEYFVH
SRSTVLLNYCRRCLSIDEETKLKKESSKEIPSFTFQELHERNITASQLFAWQAPIDLIEQ
YVNFQSENKNNNMRFFNCSDMFPIRFGNQCEYQSSVKSFTQFVKNRFQARENFRFVDQLR
SFTCYTTECKRFSENDFLCLDHREICDGKVDCIDGSDEKYCWQLEINECTQDEYRCRNGL
CIPKSFAFDYEYDCFDSSDERNLQRTQLSNACVDYWWNQCDIQRCNTGSLDFSCGDGTCS
KVSYTGRAALGQASISTCKSNRDHLYSKSIYNLSTLCAKYVACMLDVYIDSAECKIHCLK
NKCAPSISKVCPEPYFLFPTGPVLLDIVYFRYHNNRTVNFWKKNVPPEDICYDQRACRLP
SLFVFIRRKLPTDSWINIFPSLTLDSLKPIELKTSSSLSQFIVWGCHRGILIDDNDTCLC
PPAYYGNRCQYQQSHLSLIIQVIKTTYFNQEYHLFSFVIMLIHVNQSERIINSEQIYYVS
YHDCLKKTILTLPYPRNTTIFDRENIYVRIDAFTVGTMINNYWSSWIFRPLSFPFLPINQ
LAIQLVLPAKPSHRFSCNSCSHLPNHQCVLSTNNNPPKIVCIINNDQCQSTCSNGSSCVT
PNLCVCSQGRLGSQCRVPFDICNPNPCLNNGYCIALDERTIRQYQCLCKENYLGSNCQFN
KTKITIKFSQEEQILKSEAVLFHFINILKTNETIRYSIFKKISSANLVLYRTEERMLKLL
NEDRYVLPDMLQIVIAQSFGFNENDRKNFYLISKNLHDYDKNFKDSDGKIENSTRCLHLH
INKSREEICQNSQCYYDDFQLCLCHISSTKYLKCVPMKNNEIFNCEKQQQICENDGLCIQ
NYRHCPTESFCLCPFCTYGTYCQFSIQNYSLSLDALLGPYLDRSSLITNLYLILSLLIIS
FGIIFNSLSTLTFIRSDTRQVGCGIYLFYSSIFSNATLIIFSIKMIYLIKIYSSNVPSYI
SCLLIEFFLKYFPECATWLNVCVSIERLMNILLTSKFNRKKSQSIAHWLVWIILLMNILI
SIHDPLHRHVFIEPDEKRGWCVVKYPSRSWLNKYNSILNIIHLVCPFIFHIISSLTIIIK
TTQIKQTVGKENEKLIWLHQLREHKHILIGPLFLGLFALPRLIVSFLYVCNDHYYSGTGS
TFTLIYLTAFYVSFIPHTTILFIFILPSHLYKTALMNSLKRYSSS
Download sequence
Identical sequences GSADVT00032126001

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]