SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for GSADVT00032917001 from Adineta vaga

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  GSADVT00032917001
Domain Number 1 Region: 418-518
Classification Level Classification E-value
Superfamily Mannose 6-phosphate receptor domain 4.32e-18
Family Mannose 6-phosphate receptor domain 0.0074
Further Details:      
 
Domain Number 2 Region: 76-116
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000196
Family LDL receptor-like module 0.0038
Further Details:      
 
Domain Number 3 Region: 38-74
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000038
Family LDL receptor-like module 0.0036
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) GSADVT00032917001
Sequence length 533
Comment pep supercontig:AMS_PRJEB1171_v1:HG380913:142807:145619:-1 gene:GSADVG00032917001 transcript:GSADVT00032917001 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MFPSCVNLFLLSCLLTLISGGNVEQTILRGVQTSLLSMYVPSKPFTCLDGSLTIPYEFIN
DDYCDCRDGSDEPGTSACPNGRFFCENKGYVGTLIPSHFVGDGICDCCDGSDEYETNIVC
NNTCFELAQKNQAEREAKRVLHEAGVAKKKEIIAKSIASNAERQKRLIEFEEDLKLAENE
LKGKEELKRQAELPEKEAKDKHQKLWEEQHAKYEAILRNRQIREMFVDLDTNGDSLVSID
ELQQHTELDLDTENEFSVDEVRTILGADSVNLDDFNTTVFDQISNSYKKLPEPTRPPPEP
TPLPEPSLETSDNQQDDTTNVPSSSSSSHEHHTEEDMETYRQSSSIPTSLEHEKHIHDDT
APEYDEETKRLIQIADQARNEFNAVDGRILHIKQQIEDLKKQSNVDTGPQGEYSAFIDQC
YDYEEREYTYRVCMFKDAKQIQKGGGSEVTIGYWDSWTGPVDNKYLRMKYANGATCWNGP
SRSLTVTFRCGIEHKPVDVREPSRCEYAMIFETPSACDETIAVTTSHSTHVEF
Download sequence
Identical sequences GSADVT00032917001

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]