SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for GSADVT00033011001 from Adineta vaga

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  GSADVT00033011001
Domain Number 1 Region: 1224-1536
Classification Level Classification E-value
Superfamily Family A G protein-coupled receptor-like 6.87e-16
Family Rhodopsin-like 0.028
Further Details:      
 
Domain Number 2 Region: 974-1017
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000454
Family EGF-type module 0.017
Further Details:      
 
Domain Number 3 Region: 211-250
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000421
Family LDL receptor-like module 0.0016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) GSADVT00033011001
Sequence length 1544
Comment pep supercontig:AMS_PRJEB1171_v1:HG380914:28503:33203:-1 gene:GSADVG00033011001 transcript:GSADVT00033011001 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MYRLRTFICMILYHSINTHYIMYHSNTISSSYDCLYAIWDMDGKLITLAPYVHNYYLIPY
CRRPDHNEEEEEERDFIDETMGKIINSKEFKQENITGNDLLNWSFPIDIAEEYEMKNESI
LYNCSLPWFGRKCQYKFPYDLSITFSEIVNETFTGRSSEQSISTGTCYRFIENCQGKSWP
FCLDWREICDQKIDCLNGQDEEFCEELELNQCNENEYRCHNGQCIPLEFAWESASSLDCL
DGSDEREIYSYHPNGSPPSYGSDCINFPIFRCEERTARYPHHFVCGDEISQQLFRSVFDI
EETDCRQAFYCALQIKERRTILDLNDPSIQILNSTDCQPLEKKCSLKWLPLPKQATMLGL
FQLIYFTNRSINEFKENVHPDLICFNIKTCPILQDRVINIEIIDGLNCVPMSNLTISYYM
NSLSRLIETLYSIIGECLTKGTEDFCPHSWQFHCNESRKCISYHRVGDGHVDCHFKEDEI
FPDCSLNDSRRYQCHHPNIKCLSPVAIGNGFRNCFIIGDDEHIFHKGDFNKTQLYSKLCF
AVGAQIGQHNRYTENIHCELWPCDNPYVHCDKIWDCQNGIDELNCSYSNCSWNEHECYDD
QSKLFRCLSINQIVEEIDDCTSTGNGRILYFNNGSIINEKKYYSWNKTKCLHEKYICQNA
PIPSLIDNEDVCSYKLDIRMLNHLHPILLFGTNKGLCYLDIDISRDRKESFLTALRLGYF
PLVSSSSSIEHISITKKEKKKIYNSINIFETWYCNRGILILSGRNQTKTCLCPPSYFGAQ
CQWQNQRISLTLQFISPRTIFISAIFHVIIMLINEQDEIISNHEEILFAPTRDCRTKFHF
YLLYPQRPKSMSTNYSIRIDLFNKFALNHWTSWYLSIPFPFLPVNRISTQLFIPKQQSIR
SCPLLCGLHGQCKHYTNNEFKYFCLCNQGYSGRFCNESYQCQCSKNSFCLTSNICICPLD
QFGSKCYLKRTICSLINNPCQNQGLCIPTDDRIDLQGYSCHCKEQYFGLHCEYFSSQIHL
KLDQTILETSSFVFIHFITIFQYVEYERTTIVKKIPFHSNIITFYISKQFNLIFLQLSNQ
SYYLAIVRERFIPLENIHGEILSKQFCPYVKLFLNSTFLEYEQIHHPKFYSFLCRQNLHF
MCFYDENLMCVCDLDRFANCFTFNHTIDNTCQKHNDCENDGQCFQNNQTCPTMSICACKN
CYYGAKCQMSSEGNLLSLDPIIGYYIQPNLSFYHQPSIIKTTMSITLAIFILGFIDVLLS
ILTFHMKDPREVGCGYYLLASSIISLCMIIMLGMKFIYLILSQMKVIKDEFQLLVACKSI
DVLLKSFLASNEWIIACVAMERVINTMSGPTFNKMKSKRLAKWMIPIVFTLTFLSHLHDP
YYRELINDIDEDDQRIWCFVRYPSIVHTYNYFITLMHFLGPFILNTISALLIIVYVSRSR
LNVQRDKSYHQHLREQFKRHKHLLISPLALVLLGTPRLVFSFVSGCMRTPRDSWLYVLGY
YVSFIPPILTFSAFVLPSDNYKKAFRNAIQQQIIRFRSTFLSKF
Download sequence
Identical sequences GSADVT00033011001

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]