SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for GSADVT00033509001 from Adineta vaga

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  GSADVT00033509001
Domain Number 1 Region: 279-374
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000000000013
Family I set domains 0.017
Further Details:      
 
Domain Number 2 Region: 1152-1220
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000000821
Family I set domains 0.063
Further Details:      
 
Domain Number 3 Region: 147-180
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000236
Family LDL receptor-like module 0.0013
Further Details:      
 
Domain Number 4 Region: 235-284
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000034
Family LDL receptor-like module 0.0014
Further Details:      
 
Domain Number 5 Region: 53-127
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000371
Family I set domains 0.019
Further Details:      
 
Domain Number 6 Region: 431-475
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000146
Family Laminin-type module 0.011
Further Details:      
 
Domain Number 7 Region: 1037-1121
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000000121
Family I set domains 0.03
Further Details:      
 
Domain Number 8 Region: 186-228
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000017
Family LDL receptor-like module 0.00097
Further Details:      
 
Domain Number 9 Region: 939-1028
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000000195
Family I set domains 0.056
Further Details:      
 
Domain Number 10 Region: 737-820
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000022
Family Growth factor receptor domain 0.0097
Further Details:      
 
Domain Number 11 Region: 398-408
Classification Level Classification E-value
Superfamily Formin homology 2 domain (FH2 domain) 0.0000392
Family Formin homology 2 domain (FH2 domain) 0.13
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) GSADVT00033509001
Sequence length 1369
Comment pep supercontig:AMS_PRJEB1171_v1:HG380918:265451:271426:-1 gene:GSADVG00033509001 transcript:GSADVT00033509001 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAQDSIGNSASATLTMQDNDGNGGQSSRTTYPGSIAPDRRVNVRHLRIIVPNMAEGDTVQ
LQCEGAAQEDENRIQWYFNHRLLRDEQPFYSRGRTLHINPISQSHLGNYRCAIPDSGYAD
ATSDLTFIGSASTPVISFYTSPAIGAGCKYDEATCRNGNCIPRSYVCDGKNDCGDNSDES
CNHADTCQPNEIRCVDRTRGRKCVQKFWACDGDRDCDDGSDEAQHYCEILPRQRYCKQNE
YQCAGVNGTNGSPVCIPRSFQCDSYNDCPDRSDEIGCAKPTILTPPQRQIEVNLGNTLTI
QCTVRGTPAPYINWRLNWGHICIDCSEHNRCTMIQTADPNDPFVITGILTVRNVNVNDGG
AYSCEALNNQGFTFAVPDAIVSVIVARGQSSAITCGAPPPPPPPPPPPTTTTRPPPPPPT
APAPRPQVYVCFCNGHSDRCDENGRCLDCKHNTVGFHCELCAPGYQGNALSGTACDCQLI
ATASGQFCDASGTQVERGGRCICKYNVEGDRCNQCKRSHFYLNPVTPNGCLSCFCSGVSA
HCTSTDWLRQAIALPISNWNAVPIDFETNSYQAGDRIQKLDGGRELALDQNSLGRSTREV
LYWKAPSEILGNFVTLYDGNIDVHFTNDGNDQEAPSDDDFIWLRGNNIDLVHKIPSTERF
KANKRDIYSVACNERTFTRKDGASVTREIILMALADLKLLLIKINPIGGRRNAVLHAVVF
NTATRDGRSENAPTVESCRCPANYTGTSCEKCAEGYGRVHAFVGFYLGHCLSCRTLCNER
SSLCDQDTGKCFNCQGNSEGDHCERCRSGYMLNERSNQCVPKDGSAPVPTPGSSVRASYL
INKKSYDARDSKPFPITLSGGQPEQRVRLEILNAQPRTVIWRRPDGSALPATVIQIDSDL
VFRNPSADQAGNYVSTITHSDGSIETIVIHLDYHAGAALKLTIKPDFIQLKEGQRLTVQY
VLSSHEAVNVVWNRVTPDGYQPMPSYFTIEPNRLILNKATLDATGTYRVSARNTHSEDAQ
EIQIKVEPRRRVRVQGPPIIRFPQDQYSIGHGETIDVTPTITGGRGATVTWSKDGSSTLP
DGATSRSNGMLHIEGRSSDVAGQYHLEVSNNQGRVSSAVYIQWRESSNQQNNHGNGNQGN
GRDNIEIRFQPRDEQNHHLGQDIYLQCAVHGNIERPYEYAYTKDGRPLENNVEVHPDGSI
IIRNAQVNDAGRYRCEVTFPRVPSMQAQDSSYDLQIGGTNTNEGHEQNHHNDEQGRGSQQ
RMEAVEVSVEPTEVTLGRGETARITCHVKNAQQYKIVWSRYGHDTSLPDYARQDGDTVIL
EPNGNSETEQLYLQCQVDVPGQVGPHHAYAPVTIRSDDESRRKKKKRHI
Download sequence
Identical sequences GSADVT00033509001

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]