SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for GSADVT00033997001 from Adineta vaga

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  GSADVT00033997001
Domain Number 1 Region: 1-74
Classification Level Classification E-value
Superfamily Kelch motif 4.18e-18
Family Kelch motif 0.0043
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) GSADVT00033997001
Sequence length 77
Comment pep supercontig:AMS_PRJEB1171_v1:HG380923:41666:41899:-1 gene:GSADVG00033997001 transcript:GSADVT00033997001 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MHIPRRHHTATSLTNGQILVTGGHYFSSILGGCELYDPLTDRWTLVANMSVEREYHTASM
LENGLVLIIGGRSSSNI
Download sequence
Identical sequences GSADVT00033997001

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]