SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for GSADVT00035527001 from Adineta vaga

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  GSADVT00035527001
Domain Number 1 Region: 292-445
Classification Level Classification E-value
Superfamily Sec7 domain 5.1e-51
Family Sec7 domain 0.0000571
Further Details:      
 
Domain Number 2 Region: 489-612
Classification Level Classification E-value
Superfamily PH domain-like 5.9e-26
Family Pleckstrin-homology domain (PH domain) 0.0012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) GSADVT00035527001
Sequence length 804
Comment pep supercontig:AMS_PRJEB1171_v1:HG380936:234600:243005:1 gene:GSADVG00035527001 transcript:GSADVT00035527001 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAITPVVKVLDLYRHELLNDSFGVEWMDDNDENNPTNAKYSVISVRAVFNNHNAQLPKHI
WRSLDKVVPGDIIVELNGVSTTGQTVAELEKNFKLSGNRIRIRLKSDCGSSCVSSSLVDP
SYNSPSSVTSSIHVTDEENLSDTEYYQQQKKISLSKPNDHLQHSMLNGYTQYTKAERSRS
CENSLDTCGHKSPDELTLSSSSLIDLPIPSVSHADYDNLSSVNGNNHANEQLSSTSQQST
TKVSSQSSSPIFCELDQKTKDAIDARLKDIDDEFELNLPVTWETVNKSVDLPSARRLAKR
LYALDGFKSSDVVRHLCKRNDFNQLVAEEYVKLFDFQGDTLDRALRKFVKQFTIIGETQD
RERVLHFFAARYLDCNPTTFTSVDACHMLTCAIMLLNTDLHDSKISTKMTFQQFSNNLQE
LNDGVDFSKDLLKSLYNAIKNEQLMDETALGSDDYNDVRLGGHGTLHGYSNCINPFLEIS
DTSKSVEYMQGYMMRKCCVESDGKRTPFMRRSWKAYFACLRDMVLYLQKNDQHPATILVG
DTNAIRLHHAYACEAIDYRKRQHVFRLKTADWAEYLFQTSDRELMRKWIDAINLISASFS
SPPLPAAIDSSSVHFQRPLLPSVQTRYSVFEQYEHILKQINELSRQLNDLKTRTYSTIHN
ENILTTNGDIKQQPVTMKARDMIENKTRKEYFEYELKRYETYADRLRRHFQQLQLDLSCL
KPMNSNHSQDSSNHSGPIEALSGIHNIQQQSFPQHQLIPIRSTLSSVAFKKTPQSPNLTI
TNPNRYSYMMAVNTHPVTMNEHQL
Download sequence
Identical sequences GSADVT00035527001

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]