SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for GSADVT00035692001 from Adineta vaga

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  GSADVT00035692001
Domain Number 1 Region: 1302-1597
Classification Level Classification E-value
Superfamily Family A G protein-coupled receptor-like 0.0000000000403
Family Rhodopsin-like 0.021
Further Details:      
 
Domain Number 2 Region: 1034-1079
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000838
Family EGF-type module 0.011
Further Details:      
 
Domain Number 3 Region: 955-995
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000524
Family EGF-type module 0.03
Further Details:      
 
Domain Number 4 Region: 217-254
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000859
Family LDL receptor-like module 0.0022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) GSADVT00035692001
Sequence length 1603
Comment pep supercontig:AMS_PRJEB1171_v1:HG380938:104627:109438:-1 gene:GSADVG00035692001 transcript:GSADVT00035692001 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MFFEKLLVFCLLIRLVKLEIQINFQLTDWTNENHDFQHHCLNVAAHIIKDSDPRQIISYC
MGEWSSNFNLTENNFESKFNFSQLAEQHVTIEQLYHWSASIDLIENYQIYLDQLLSSDEI
SVSLATEVFYNCTLPYFGWRCQYALINYTANYSSLNEFVYDYYQNNRYEPAELTCYLHLN
CKRGPLPACLDWTEICDGIVHCLNDGLDEKFCWQLEIHQCNENEFQCGYGQCIPKSFTRD
PSSAPDCLDRMDEHMSASFLLDNTDDQLYTREPIFAREDVSCTRFGKIFSKYRQTLTSSC
GPNREYLLGKALFSIKPNDLDDECWSLMKCIMQMPYSLEPTLTNILVPSLEICEYLSNKN
LFNQIVKTKCPEMISISDDPFLHGQVYIVYNKAKLKYSSRPLPPTYICYDDQYLPIPNDG
KAFLLPTINKTCRFYTDVVNSEVSFWETRWLQLYIKPLTEWLRTNIALISNDSTFCNQSM
IYQCRDSLKCISKNRLLNTIMDCYYGDDEDYLTISNNTDLMKQLSHYTKCKGTNEYIHIA
QVNDGWSCDCKVPGDNYCSDEEFGENYFKNTILFQTICDKYLHLSQEFVEDKNETDETNC
EHWPSLHIYNRCDGFWHFPNGIDEINCDPSIALLNCSENHHVCVSIETKNLICLPIEKAN
DGIIDCIGAADEPTFCDRTTINESNPYTFYCKYSDRKTCILSHRICNDKIDCEIDGEDEL
VCQSNDLTGKPVTRGICAREFELYGSDIAKSLCRSFIQIGKRSHIYFTLDQSQNSLGPSI
EHGFLSLSIDSSETSEVIEPYQPHCHRGFPLQLRLNKELNLTSIICLCPPSFYGDRCQYQ
NQRISLTVQFHATAYSRQIPFIIIISLIDDSNERLIHSSEQLNYLFLKDCQKKFNFYLLY
STRPKNLQNNYSLHIDIYERRTLTYRASFIKHLNHSFLPVHRLVFQFNIPNSPDEIDNCV
TNQCIHGKCIRYFDDSNNESFCQCDSGWTGQYCTIEYSCSCSTKSLCLGQLANNRSLCVC
PMNKMGPRCLIDNNRCQEEICMNGGTCIPTDEYETSKNKSTCYCPKGFSGHHCEISRTKF
IISFDQTPDLHSLIFAHFIQIQTNNFPVRTTTVKRITMVQNFITIYWSLEFHLLFIELPN
KNYHLIYMEKTYQPQMMIEKKLTSRSECLNISEVFNQTILDYHRLHRIKYYHLPCQINLF
LTCFYDEQQFCMCQQVMNEQRVSNCFEFDHNTRTTCLGKSDCSNGGDCYQEKSPCPKYFL
CQCPVCYYGTKCELTTNAFSLSLDAILAFHIHSNRNIIKQSYIVLISEIFSILIIISGLI
NGILSLLTFKSGKLREFGCGIYLLFTSVIILLTMIIFTLKFWIFIYSQIGLIQNELFLKF
QCIFLDFLLRICLTMDQWLTAFVSIERAIIAVKGINFNQRKIKSFAKYIICFLLFIIMLT
CIHDPLHRNLYNDDDDEKRFQCIAKYRSSIRLLDYVVNTFHFIAPFIINIISTSIIIISK
TQQRKSIQKKQKYGIILKEQIQQHKNLLIGPFVLILLVIPRLIIAFASSCIRSASDSHLF
LTGYFISLIPSTLTFVLFVLPSTVYKQEFHKAISRYRNLFKIY
Download sequence
Identical sequences GSADVT00035692001

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]