SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for GSADVT00035703001 from Adineta vaga

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  GSADVT00035703001
Domain Number 1 Region: 1206-1496
Classification Level Classification E-value
Superfamily Family A G protein-coupled receptor-like 0.0000000000000011
Family Rhodopsin-like 0.024
Further Details:      
 
Domain Number 2 Region: 943-985
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000391
Family EGF-type module 0.017
Further Details:      
 
Domain Number 3 Region: 523-556
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000969
Family LDL receptor-like module 0.0028
Further Details:      
 
Domain Number 4 Region: 869-904
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000259
Family EGF-type module 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) GSADVT00035703001
Sequence length 1501
Comment pep supercontig:AMS_PRJEB1171_v1:HG380938:153747:158252:-1 gene:GSADVG00035703001 transcript:GSADVT00035703001 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLHLLLFIFFLSIRVESHFNFYITNHLQHDCLRFYSIRLNTLIKTEYCLRPTDHTHLITT
DYFNAQEHNFTFHQLHQMNVTAYQLFIWSASIDLAEQYQHHIQQHNQSLQSNQLFYNCTH
PWFGSRCQYSFQIDQLQPLIELKLNLPATNSTCYTLLECDRGGSYLCLDWREICDGRIDC
LNDGGIDEVHCFNLEINECQPNEYRCHNGLCIPEYYRTAEQITGACLDQSDAFNTLPCPT
HGSPSSLFHCEENTCPPGRNTFSCGDGQCVEDYEQCDNGRHLMLFKSLIVQGNLSHNCWL
ALICLTRISHQIHETQCVEFFHSLDAIHHLHTCDDLIHFPITPVLYGHVHFLYRPKDVLE
ISKSSALAPDYICYDERLCDYLSPTFRFESHACRHAHEMGFTMNAEYLSWKAIIDTVKPY
FYGCNARYTDQYDPKHVSLYRCKNTSKYISKHRIVDNIVDCHLEDDERDFELSCSLDDPY
RFGCSNRPLSAHTEGKNSDNILFNQICNGMIDLTPQSIDGRLQTDETKCDYWPCNTIYTR
CNGVWDCPNGEDEENCRSSNCSHRHHLECISLLNHTKICLSANQVRNGIVDCLGGLDEFH
LCQTVNFYGGISYNFRCFDEAKCIDSSMICNGNDEISDVELCNEWTHYNLTELKSILCRI
STLERVAFTLETSQIYPIIENQITNRIPHFPSRLRNDGDEIIFPFKNVIASSPCTRGSSL
YLRLGNTSYTSICMCPPNYYGNMCQYQNQRVSLTLTFLAINKHHIYAIFIKLIDDDDDDD
NHHHQEIQSYEQIIYVSKTTCGQPFDRYLLYSTRPKNLSKNYTIHIDVYDKISLEYISSW
YFKVAFSFLPVNRLAVVLTLGTNRAVQSSSCSLPCEHGVCMKYMNEEKYFCECRRGWSGA
ECHIPIDCNDCSSDSKCVGNVKNRSICICPLGKFGSRCLLEHSCPVNYCRNGGQCVVTDE
IVTDNSYECLCTEEFRGKRCEYSKSRLYIELYDRGFSSYLLAYIYSNIQSEPPEAQQRIL
RKLSRMQTNITIYSQHPFQMVFILTNNKYFLAVLHKSEVYNISTVIDSNRQCLSVNELLT
SKQMKLTKIDRIKLYHTICRTRRYLQCFFDESNMCLCTTENYANCFPFDHGNNFQCSRNV
HCLHGGQCLQDHPTCPLTTICDCVDCFFGDRCQFYAKGIGLTLDDLFRYEIRPNVRIIDQ
SIMIKTSIFFILTLFILGFVNSILSLATFSRVDSRQVGCGIYLFTLSITSLLTLTMLMLK
FWFVLLSQMNASTNRVVLRYGCLFLEPLLKLFVWTNSWLNACVSIERAVNASKGIHFSKS
TSMYVARRIVLVLPLLILGSNVYECLSRDLFDDVEEGRVWCVTLHSSTLYIYTTVVSFFH
LCIPFVINILSAFCIIYRITRQRAITRTYKSRFQHLKEQLNQHKHLVISPVILIVLALPF
VVISLLFRCVKASQSSWLYLLSYFISYIPSTLIFMIYILPSPWYRGAFLEAVKKWRGLCS
C
Download sequence
Identical sequences GSADVT00035703001

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]