SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for GSADVT00035713001 from Adineta vaga

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  GSADVT00035713001
Domain Number 1 Region: 1216-1508
Classification Level Classification E-value
Superfamily Family A G protein-coupled receptor-like 0.000000000000211
Family Rhodopsin-like 0.015
Further Details:      
 
Domain Number 2 Region: 946-985
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000957
Family EGF-type module 0.027
Further Details:      
 
Domain Number 3 Region: 531-572
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000615
Family LDL receptor-like module 0.0041
Further Details:      
 
Domain Number 4 Region: 216-258
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000916
Family LDL receptor-like module 0.0017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) GSADVT00035713001
Sequence length 1514
Comment pep supercontig:AMS_PRJEB1171_v1:HG380938:179574:184184:-1 gene:GSADVG00035713001 transcript:GSADVT00035713001 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MNTFLLFIISNSFIISNSNIWRPFYNLYNTDTMTNDFDHHCFYSVITKNVNADDKSYKIE
QNVEYCIRTTEKQVIDMNEKAISSILAFDELKKKNITSTNLMEWSSPIDVIEHYEEYLQM
NKSSSVGAFYNCTPPWFGPICQYRFVLNQSFSSFIQMRIDQRNLFEENTTVTCYMHIECT
VDLSLICLDWREICDGKVDCLNGGEDEKYCLELELHQCEENEYQCRNGMCIDEAFLMDEH
IKVASRECLDGSDEIQYHLVNYCARDASFICEDITHFTCTNNRNQVHSYLFDWYNLADAQ
FSHCFKTLMCATDSWLSRNFDEYCKNLCDTTEECKMQTLRQCPASFIAPNFPIWHRHVRF
GYFSNQTSMKINADKPHFVCYDKNLCPLFKSTLTFDNYTCLLIDKLNLSSIENVREIFRS
CNYIFQTGNETNCIDSTMARCLGTNKCIPQRRIMNGIQDCYDGFDESLFAKSCALNDKYR
FQCTSEQKCLSSILVNNGKKECIDGEDEPQLNSFITNIHKLPFSAICDQEVNMLPVINDT
DETHCELWPCVNQYTRCNGLWDCPKGIDEINCSSLIQCPANHHPCMLPKNRTLGCLHMNY
IDDGIIDCLGSTDEQSYCRSLYSEDLLKYYRCWNDTKCVPFTRVCRDCHDFNDMNILCDI
SNDTVTHIIQYFLRKADRFMYRRKPFSHRSSRSFPLLQLPSLHLKQIHNGIIKTEKIFSI
QHINDSRLWLCNKGFAILVGKHETEQCLCPENYYGHLCQYQNQRVSLTIRLHQEHLEKFN
IIGMVIRLVDHTGFVNFYEQITYIPVIDCNTKYNIHLLYQNRPKDMTKNYTIYIDVYDKV
NLLYLTSWIYPVKLLFMPVNRMSVQLIIPTKQDCRLLCSEKYLEPLVNSHMQSCRCSNRA
NSILTIEHKCNCSPRSICVGLKENRSICLCSSNDTGPRCYLKSICQMNSTCMNQGICIPY
DSRHSSTKFTCVCPDGFFGEYCEKTDVRIDISFSDVEIPQSVLVYFINVVEHNIFSLETE
PTQVTMFKKIPLKQKTITLYMSLSFHLVFVQIDHMYYLVVLQHNYTSSIIISTQITQSQR
CPHIRELLDKVIIDKPLLYVVKYYHTICQKHSDLLCFHDSYTFMCLCTEDRQTNCFHFNY
NTTYNCSGYNNCQNDARCFQDHPHCSTRIMCVCQGCFYGDKCQLTTQHFGLSLDSILGYH
VYPHFTFTQQSLPVKISISLATLLVIIGLVSGILSNLTFQVRSTREIGCGLYLFTSSITS
ILIIIFLYTKVWLLILSQMQMITWRSILLFNCIPVEFILRVLLATTDWYHVFVAIDRFLV
VFLGVHFDKTKSQEFAKRIIFIIPLMTALSILHDPIHRHLIDDIEEQRTWCLVKFTSTME
TYNRFINIFHFIVPFSLNVILTIGIMIFNAKQRSSAKRQYTFEQQLKRQFSRHKHLILSS
IILVILALPRLIISFVSNCMKSSKEYKIFLVSYFISFVPPVLHFFIFVLTSEMYRREFNA
IIRRKWKAFRRCFV
Download sequence
Identical sequences GSADVT00035713001

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]