SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for GSADVT00036326001 from Adineta vaga

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  GSADVT00036326001
Domain Number 1 Region: 45-235
Classification Level Classification E-value
Superfamily Sec7 domain 1.31e-61
Family Sec7 domain 0.00000219
Further Details:      
 
Domain Number 2 Region: 248-368
Classification Level Classification E-value
Superfamily PH domain-like 6.58e-30
Family Pleckstrin-homology domain (PH domain) 0.00015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) GSADVT00036326001
Sequence length 376
Comment pep supercontig:AMS_PRJEB1171_v1:HG380944:166079:167768:1 gene:GSADVG00036326001 transcript:GSADVT00036326001 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDVIRRRKEQLKKEIQDIREKIAQCEIEMSMIQSHSNDDRRHSNVKQWSTGKKRFNDNPK
EGIRWLIDNGLIQNTSEHTAAFLFNETGLSKRAIGDYLGEKDDFHIEALKHFAHMHDFFS
MDIVDALRRYLFTFILPGEAQKIDRIMEAFAQRYYECNPHIYASAEVCYIVSFAIVMLNT
SLHNKNARLGGGPLTYEKFVHSLNETIARNQMPDQNIIKNIYDNIKNNELKFPDGDVNST
MPVFGSDSTVLKEGWLWKQGGRVRNWKRRWFIITDGCLFYFESSSEVENPRGVIPLVDVG
IREIDDDRTKQFCFELFPLTGDKVKASKPAPGDLGKWIDGHHTVYRMSASSEDDRKDWIR
ALRIASQNQLPKQRLS
Download sequence
Identical sequences GSADVT00036326001

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]