SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for GSADVT00038896001 from Adineta vaga

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  GSADVT00038896001
Domain Number 1 Region: 21-188
Classification Level Classification E-value
Superfamily MIR domain 1.83e-52
Family MIR domain 0.00000252
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) GSADVT00038896001
Sequence length 226
Comment pep supercontig:AMS_PRJEB1171_v1:HG380958:254060:255024:1 gene:GSADVG00038896001 transcript:GSADVT00038896001 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MNIIVQCSLLIFLFDSVLTQQDAVTCSSTFKLVNQQSGDRLHSHDVKYGSGSGQQSVTGS
PNADDVNSYWQVQGENCDRGVPIKCDSIIRLIHVVTKRYLHSHDFASPLSHNQEVSAFGE
DGVGDAGDRWKVICTGRNDYWLRKDGIRLQHVVTRKYLHLTGDTYGRPIHGQKEISCYSH
ANSQNIWKVDAGVYIRTSSESVSSTRDEQSDTRSQSTSTDHFDDEL
Download sequence
Identical sequences GSADVT00038896001

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]