SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for GSADVT00039217001 from Adineta vaga

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  GSADVT00039217001
Domain Number 1 Region: 892-1189
Classification Level Classification E-value
Superfamily Family A G protein-coupled receptor-like 8.7e-19
Family Rhodopsin-like 0.0089
Further Details:      
 
Domain Number 2 Region: 616-667
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000335
Family EGF-type module 0.013
Further Details:      
 
Domain Number 3 Region: 136-171
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000615
Family LDL receptor-like module 0.0037
Further Details:      
 
Domain Number 4 Region: 547-583
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000419
Family EGF-type module 0.021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) GSADVT00039217001
Sequence length 1191
Comment pep supercontig:AMS_PRJEB1171_v1:HG380962:27466:31134:-1 gene:GSADVG00039217001 transcript:GSADVT00039217001 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MILFPSAPVIYGHIRFIYFSNRTNWFMNVAPDLICFNSIWCPSFEISAIIDNFTCIHFTR
LSFDERYQNWNDMILAIANLFRECSHPQMQIKDRACLHSSLIPCGNSSKCLSKYRLKDKY
NDCSNSLDEFSTKTCHLNLTHRFKCTSEDECIPLLMVADRHADCLDKSDESIRLENCPKS
GKDLYETNCEQWPCVTYYTGCNYVWNCKDGRDELKCYDIHQCPDGMLYCFDRNLNFHCLP
SNTEQIDTSFCIGSSNDREFCRKQYPHNLDLRYRCLNDSKCINPSQLCDCQIDCPLEKDD
ENLLCTWNDQCQSNQYRCKDGTKAQRCDVEIQCNSKEDELLCDLSDIPSREMFFGIANSD
YNRYPSMIIEYPSNPTKFIQYKRKTTSMNDLPEEYLGWYCHRGILIRTIHSYFCLCSPAY
YGNRCQYESDRITVILQLHSPPLVVRNQIFKFLIFLLDRDENIISYEEIIYSDMNFCLAK
YLLYLLYPTQPKLKTNYSVRIDQFILTREQGIRYGQSWFFNNIPFHFLPINRITSLLKFS
IKSASIVRCGQVHCIHGRCVQYVNIPQIFCHCDDGWLGKLCNIRANCQCSQRSLCISNNS
CLCPIGRIGPLCRVPYNPCHSNTCRNNGTCIPVDSRAITDYYYETQQQYVCICLDEFAGR
YCEIISARIHIQLPSLSISSVLIHFIKTAERFLFTPRRRSLYRRIPSNLDSNLTIYTTFI
DPPDYLPNLIYIQTFDKNILSQYYLVGIIPIEQNIKELNTSVQSSHRCPHINELFNSTIL
HLNPLQRIKFYQYPCLEKEIHCFYDENQMCLCNKFHHVDCFEFNQSLLLCDQSICENNGI
CIRDEDTCNPKSLCICQTCFYGIYCQFTTQKYVLSLDGILGQYILQEIQLKNQPFLIKIS
ISIISIMFVLGVLLNLLSILTFKQSKIRDVGCRIYLLSSSIISLMIMIIFLLKLIYLLTT
QINIFVNENINFISCILIEFFIRTLPAIADWLNASVAIERTITTTFPTSFHRQKSVQIAR
FVTISIVLLNILSSLHDPINRRLVIDEEDQRQWCTVSFKNQPWLNDYNSIMNFIHFIIPF
LINLLSALIIIIQTARIRSNVRKQISYRNHLKIQFQEYKHLIISPCILILLALPRLIISL
VYACMKDERQPYLFLFGYSISFTPYLAIFIIFILPSETYRKDFCRAWKLLF
Download sequence
Identical sequences GSADVT00039217001

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]