SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for GSADVT00039504001 from Adineta vaga

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  GSADVT00039504001
Domain Number 1 Region: 125-194
Classification Level Classification E-value
Superfamily AN1-like Zinc finger 1.03e-25
Family AN1-like Zinc finger 0.00028
Further Details:      
 
Domain Number 2 Region: 10-46
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.000000000385
Family A20-like zinc finger 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) GSADVT00039504001
Sequence length 199
Comment pep supercontig:AMS_PRJEB1171_v1:HG380964:268444:269230:1 gene:GSADVG00039504001 transcript:GSADVT00039504001 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEQPESNPTFCTNNCGFYGSSQFEGMCSKCFREQVDRSYNTGFYSSSNLPVTSANLLEDD
DVADNIISPISPIENDNSEDQLKQENHASPLLHVASAPTISTTLNSSMKNDSDIAESSSL
SASPTNSSSVEKKKRNRCTWETCNKKLGLTGFDCRCGGQFCSLHRYANEHKCTFDYKEHG
QNEIRKNMPVVQAERVRRI
Download sequence
Identical sequences GSADVT00039504001

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]