SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for GSADVT00039765001 from Adineta vaga

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  GSADVT00039765001
Domain Number 1 Region: 1-78,136-232
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 8.69e-24
Family Tandem AAA-ATPase domain 0.086
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) GSADVT00039765001
Sequence length 260
Comment pep supercontig:AMS_PRJEB1171_v1:HG380967:237928:238710:1 gene:GSADVG00039765001 transcript:GSADVT00039765001 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLDTQYRMHPDICRFPSEYFYDNQLLTDQSVEERMRHFTLKSLYVYDITNSQHQYDGARS
SFNEDEAKCIQKFCQRLIAYLATQSTPVSSDNEDEDESSTDSSSDSIHSSDDDDDDDNVS
IRDRDIRRRQLQPLLLNDPRSIKIQQRIAIITPYKAQVRLLSSYIPPYIEVMTVDSSQGK
EKDIVILSCVRSGDTIGFLEDMNRLNVMLTRSKYALYIFGNLTHLSNQHDSWKELLEHVH
GRRIISNVNVHNLEFELPYR
Download sequence
Identical sequences GSADVT00039765001

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]