SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for GSADVT00039911001 from Adineta vaga

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  GSADVT00039911001
Domain Number 1 Region: 5-95
Classification Level Classification E-value
Superfamily Sema domain 0.0000000000000017
Family Sema domain 0.0024
Further Details:      
 
Domain Number 2 Region: 150-214
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000000000565
Family I set domains 0.031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) GSADVT00039911001
Sequence length 290
Comment pep supercontig:AMS_PRJEB1171_v1:HG380969:109766:111182:1 gene:GSADVG00039911001 transcript:GSADVT00039911001 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSDTIITRLVTDSINSNTDHQMTVVYAGTQDGQIFKLVQKKTGEKFTLLTSWILEENTNE
KSPIRNMVLAQDTKQLYVSTDAAVYQFPINQCSRYMLCMECERDPLCHYDVQQNRCLNVD
ENNVKLAIARLQPESWCKKSVQRPSKILQLTRKKGETVWLQCDVSEHLRTSIEWRWNGRN
IQETLFNNYLLTKEHNLIIINMNNSLNGQYTCFVGHQPIVSYSLETDRDAFVYGDVSTTI
TNLSRRNGECNCLTAEKYIEKYNDWCKEFENYQRAYNEWEVLRDQSCPKP
Download sequence
Identical sequences GSADVT00039911001

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]