SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for GSADVT00040090001 from Adineta vaga

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  GSADVT00040090001
Domain Number 1 Region: 1297-1586
Classification Level Classification E-value
Superfamily Family A G protein-coupled receptor-like 0.00000000000366
Family Rhodopsin-like 0.011
Further Details:      
 
Domain Number 2 Region: 1029-1073
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000311
Family EGF-type module 0.015
Further Details:      
 
Domain Number 3 Region: 949-989
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000157
Family EGF-type module 0.025
Further Details:      
 
Domain Number 4 Region: 596-630
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000463
Family LDL receptor-like module 0.0034
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) GSADVT00040090001
Sequence length 1603
Comment pep supercontig:AMS_PRJEB1171_v1:HG380971:44335:49146:-1 gene:GSADVG00040090001 transcript:GSADVT00040090001 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MMLIFLKIFFDFMIICLHVSSYEINLELTDWTSNINEINMDLQHDCLYISMSIEPQTISW
HLEHYNITRNFRQMTSLCLSEWPSTWKIQDNTQDQQFTFSRLAELNITSLQLYYWSAPID
IIESYQFYLNQLSTSNDLSLSKTIFYNCTSPRFGPQCQYSFPFRTKQKLSSVHELIHRFY
IALGYPVDDLICYDHLQCYFGSTLLCLDWNQICDGFIQCTSGIDENYCWQMEINECKENE
YRCRNGQCIPLAFFDDNPIAAECLDRSDTKEKFDWNIELREKFDYLRPVFLNEEVLIFNG
TAHFGSYFEVRNRRAFFVHYMMLEQTHSMSYTCWLSLYCYLGFEIQMDKICHEICSNEHC
QEMMNESCSDMFYLPSVPIAFGHIYLAYSKQYLIQQKIWTNAPEYICYNEQLCGGFNSNE
EILYFNNSLCRRVQDILPNVISDRDAIQMIWNYIHQVSMYLTKCNTILQNDTIICDNQTM
YQCLNSSKCIGKIRIFDQFQDCDYGDDEDIQNKILINEICLNEQSSTHFICPNTNKCISR
KLIRNSQCDCEYLDVEHLICPDEDIEKKSIREIISFPTICNGFNDLNPIIIDGQNYTDET
ECDQWICNNPYTRCNGYWDCYDGADEIDCQQFLLDLNCSNHSFLCISSHTHNFICLSMEK
GNDGHIDCLGGTDEPYLCRYNTQIYDNGFYCKSSQTFLPICIQRHEICYTNVTCSNMEMS
KLCKMNFEQNMFRSGVCDRGNFAILNTIDMRICYLFRFTPRHEIQHFSLVEIKSIYRDEE
RIPIPVDTLIDIFDPVREHCYRGVPLTVTLDLNKNFFYTTCLCPPNYYGTHCQYQNERVS
FTMKLQTFSDSWQIQFLLVISLIDNSYERIIHSYEQITYFPIENCQTSFDIYLIYSNRPK
NQTKHYSIHIDIYEKLSLNYRGSFLIHIPFLFLPVQRIASLLNIPYKNYPMKNCFLNECL
HGECIRYFQNDKTFCKCFSGWTGQFCTIKYQCNCSLDSICYDRSINQRSICICPIDKWGP
RCLISDEICSLNNPCQNNGTCISYDQHVSPRNTFQCICSKEFYGQRCEYLSFKIILSFSN
HINIPETMLIHFIQVKNREEPEKGIIFKKIPINRDSIIIYWPKTVHISFVELFLNQYYLI
FLEENPNQTHTINKQIQSSDYCPHIREIFNETFAQLHLIRRIKFYHFICRNYSKELSCFY
DDIYICFCIQFNNQRQVNCLEFNHTLKRDCSGRSICENGGQCLQDSSICPQTSMCICPLC
FYGSQCEFTSNGHSLSLDAILGYHIQPFISLKQQPIIVQISLILVVTITLIGMINGICSF
MTFKQKELKETGCGIYLFSSSITTLFITNIFFMKFLILIISQITYVTNISFLKIQCHSID
YLIRIGLNFDQWLNVCIAVERAITVINGIHFNKKKSVKTAKYVIIILIIVIISSNIIDPI
HRRLIMIDNNDEKRILCILDYSSTIQRYNMIVNIFHFCLPFIINLISILIIIINGAHLKS
SLQTRQSYKRHLIEQFQQHRHLLISSFSLSILGIPRLAIMFSGGCMKTNADSWWFLCGYF
ISFFPPMLNFAIFVLPSKVYTKHFYISIAYYRKFVRRRIHPMP
Download sequence
Identical sequences GSADVT00040090001

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]