SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for GSADVT00040245001 from Adineta vaga

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  GSADVT00040245001
Domain Number 1 Region: 1232-1522
Classification Level Classification E-value
Superfamily Family A G protein-coupled receptor-like 0.000000000054
Family Rhodopsin-like 0.021
Further Details:      
 
Domain Number 2 Region: 969-1011
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000214
Family EGF-type module 0.023
Further Details:      
 
Domain Number 3 Region: 898-930
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000503
Family EGF-type module 0.022
Further Details:      
 
Domain Number 4 Region: 640-672
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000327
Family LDL receptor-like module 0.0033
Further Details:      
 
Domain Number 5 Region: 221-259
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000036
Family LDL receptor-like module 0.0014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) GSADVT00040245001
Sequence length 1525
Comment pep supercontig:AMS_PRJEB1171_v1:HG380973:110304:115190:-1 gene:GSADVG00040245001 transcript:GSADVT00040245001 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTVFGLLLVIWVLQLLVYAQLNLYNTEQITTTNMMRYDCLHYYARGENVDIRYDTSIKQV
IKYCIGPTDNIDIVWTNSETIYHNNFTFDQLRFLNVTIEQLLSWSASIDLVEKYFLYING
LSLLNELFYNCTNSWIGSQCQYSFIYDTKESFALVVENKFHQIKSSVEDGFELMKLPCYN
HLPCNRGGNDFCLDWREICNGQIDCMDDGMDEADCFQMEINECQEDEYRCHNGLCIPKDF
WKDDKDNPDCLDRSDESNIPLSFDFCYQTPTFRCEEHTCRPGNEDFSCGDGQCVKEFDVC
KNARNDLFKESLLIKDDLSNECWLYLTCFSLITHNYDGKLCHSIIHSFNGNNAKLSMCQS
IFQFPKIYALLGHIRFFYQTHVIYFNILLPDIICYDQSLCNFISPTFHYDNMTCLYRHQL
NLSKTDNYEEFTLAIKDYFRGCLTTTNDQFQLDSSLYCCQNSSKCISKHRLLDGILDCHM
GDDETYNLSCSLNDSFRFKCDRKDNQCYSPLVNSDICKRHVKTNINEINFQDFCDGIDDF
FFQEIHGKHYTDETECNSYWPCNNIYTRCDQRSACSNGEDEENCIDSKCPSYSHPCISME
NLTVICLSVEHINDGTIDCLGASDEFEFCLKKKSTLDNQGIFYCFGNQKCIPSSYLCDRK
SDCSRNENETFCGNDQSICSENYHGNRSNIEQILCQRYNKKVDRKYFSLKTSFEYPLWQM
EQSSKVKQLPIEDIKSNLNDSSWIQLCNRGIYAQIQSDDDNNTYRCFCPPSYYGSQCQYQ
SQRVSLTLRFLPFNRHSIYSILIKLIDQNGLINSYEQLTFMSIWGCKFKFNIYLLYSTGP
KDPLKNYSLHIDAYEKQPLIHYTSWFLPISFNFLPVNRVAAQLVLPIERIKPVHSCYLTC
QNGGQCLKYENTNEFFCKCLSNWSGSQCETFEHCNDCPSDSICVGSINNRSICICPSNKA
GPRCLLPSNCPLNTCKNDGQCVLIDNTIGTNSYMCMCSDEFYGLNCQHRKIKLTIDLTRI
EIPTHIQVYISSISNQSQPSNLIFVKKLTHEQNIVSFYLSIPYHMVFIKIIDTFYLAVVQ
QNPKDNLLTSISSKQRCYPISEVLNSSVLILPMIRRVKYYPLICQKVNKPWCFYDEMYMC
LCTSEFYPNCFQFDHQQSKFICSYNNYCKNNALCLQDDPTCPSNTICICSDCYFGTQCQF
YAKGFGLTLDDILRFEIRPKLTLFQQKISIKISAILTITMFILGLINGFCSSLTFQRENS
KKVGCGLYLLSSSITSIFTMMIFTTKFWFLILSQMNLITNRLILLIGCISIEPLLKIFLS
IDTWFNACVAIERAISVFQGVQFRKQTSKNIAKRIRILLPLVIVCTFIHEPIYRDLFDDE
EEQRICCVTNYNQFLQTYNSTIILILFLIPFIINVCSALYIIRNVSRRRSAAQTEYSYLQ
HLYKQFLECKHILISPLVLIILSSPRLIISLMSSCIKSSRDPWLFLSGYFISFIPSMLVF
IIFVLPSDLYKKEFKESIQSWRSSH
Download sequence
Identical sequences GSADVT00040245001

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]