SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for GSADVT00040532001 from Adineta vaga

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  GSADVT00040532001
Domain Number 1 Region: 1271-1569
Classification Level Classification E-value
Superfamily Family A G protein-coupled receptor-like 0.0000000000183
Family Rhodopsin-like 0.024
Further Details:      
 
Domain Number 2 Region: 998-1045
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000044
Family EGF-type module 0.013
Further Details:      
 
Domain Number 3 Region: 458-489
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000287
Family LDL receptor-like module 0.0035
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) GSADVT00040532001
Sequence length 1580
Comment pep supercontig:AMS_PRJEB1171_v1:HG380976:215838:220580:-1 gene:GSADVG00040532001 transcript:GSADVT00040532001 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MIVNYLFYSIQFYVVIAIPHFNLHHTDWTNENESYTTLQHDCLYVSVSTEKGTDSYQTIS
YCLTEWPSKWKLVENEYDQKFTFEQLYEQGVTSEQLYFLSASMKLIEDYQEYFDQRSIKS
NEIKEPSTIFYRCTLPKFGSKCQYSLDTYRFNHGSLSELVYEFYNMKYTPTTRTCYTNLE
CDRGLSSICLGWYEICDGIVDCFNGGIDEKYCWKLKFNECSDNEYQCKNGQCIPLDFFQD
RVYGNENIECLDESDKYHIIPLIQIKPRSVEPTFFNEDIQYTRYKTIRSSVSKHIELLTG
QIFIETPSSITNDCWLAFKCHYNIMHNIDPICDGGNHFNISFLDIINITCPEIFMIPATP
IAFTHIYFLYLKEIIFKSDYMFSPHYICYDTRYCDGFLSNRTLISFNNLTCRKSEDFPVF
FTEEKINSKMEYYIDEIYKQLNRCNTILYDNSTICVNSQMYQCFNSTKCIYTDQLCDGII
DCNDADDEYCPIINDTCKKGQFKCTLTEKCISIHLIHNIDCDCRTPLIESCEDEIDLFDL
KKDYIPYRFVCDGYLQLKPILIDNRYESDETECDYWDCNNTYTNCDSKWNCWNGADEINC
NPLVECTFNHHQCISSETNELICLPLEKTGDGHIDCIGATDELKLCRLTQLTPFKNFYCK
NDTNHTCIYSDRLCAEDNRCLNGEDQQLCSSMKNISKIETICRYAHELIYTKEHHFICNR
YHEDYRLLEQYFKPDHMKFPKKSPTEQIKKATMMIEHLPPSEITRSYQQRCHRGLPLHVW
LDNKNDVSIEACLCPPSYYGETCQYDRQRVSLTLQFKVHADSRRILFTIVISLIDNDSNE
RTIYSYEQNTYFYFRDCSKKYNVYLLHPKYSYSKTYAIHIDVYEKISLSYRGSFYIPIPY
RFLPVNRIATQLIISGKINGIKNCSNQLCQHGQCLYYINDQQNRTFCHCNQGWYGKFCTI
PHICQCSSDSPCIGVTANNQSVCICPVNRWGARCFLHSNPCQSNGNPLCLNGGQCIPDDK
QSQLSTTYFCLCRKGFRGENCEITDRYLKLSFHKDIILPQSIIIHFMGLEKTNKRFLSSN
SVVQRISLYQNEIYAYWTNDFLIAFIQLLNNYYLTLVPDEHNAPLKSYNQTILPSYRCKH
VGEIFNETILSLHPFRRLKYFQIPCEQYAPDLNCFYDDTYFCLCYDFNKKRLSNCFKFDS
RSSATCQDLSDCENGGQCIQDGLKCPRASICVCPQCFHGTRCQFNSHLFGLSLDAIIGYY
IQPHVKLIDQSFIVKFSLTLTILVAILGVTNGILSMITFKSTELRKSGCGLYLLGTSITT
FFTITIFVLKFSILLQAQIVYIMNLTFLEIQCYTLDFFLRISLCMDQYLNACVASERALT
AFRGISFDKKKSKQMAKYIIILLLFWTISTTMHDPIHRRLLQDNDDDGEESEKRIWCIVS
YSSSVRIFHSIINLIHFFVPFFLNLISALLIIFITSRQRRKVQHRLTYRQIIREQFQEHI
HLLIAPIVLVLLALPRLILSFIAGCMKSSRDVWLPLAGYFISLIPPLLTFIIFVIPSKFY
TKEFQKSIKEIQTRIRSYFS
Download sequence
Identical sequences GSADVT00040532001

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]