SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for GSADVT00040993001 from Adineta vaga

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  GSADVT00040993001
Domain Number 1 Region: 155-193
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000484
Family LDL receptor-like module 0.0029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) GSADVT00040993001
Sequence length 301
Comment pep supercontig:AMS_PRJEB1171_v1:HG380981:207025:208295:-1 gene:GSADVG00040993001 transcript:GSADVT00040993001 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKILILICLISSISSTIDKFVIHSIDDCWINERNITISDTYGVLISFSPTLADRIDPCSI
HISNPWSSDIQNGLAVYFPHTMDCSSTITVDCLPGSALLHQTTPTSIQFKCRMNSSDIIM
PCSSISLTSKRNTSHTGSRRVVDIQVIALAKEPCTNKDKFFQCSKDYPRSCIARKLRCNG
QTECPSGDDEYRCENSYGEGYVPLGLIILLILGFMFVACIVSTVLICCFCRAACHAIIRR
FHPSKKQKLFQKGDITVISGEEAGLMKGLTASSVVDALPQQHTEPTSLIIDSTKPVYPRL
P
Download sequence
Identical sequences GSADVT00040993001

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]