SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for GSADVT00042155001 from Adineta vaga

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  GSADVT00042155001
Domain Number 1 Region: 1297-1605
Classification Level Classification E-value
Superfamily Family A G protein-coupled receptor-like 0.00000000000022
Family Rhodopsin-like 0.023
Further Details:      
 
Domain Number 2 Region: 1029-1078
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000144
Family EGF-type module 0.018
Further Details:      
 
Domain Number 3 Region: 947-991
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000957
Family EGF-type module 0.015
Further Details:      
 
Domain Number 4 Region: 473-509
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000755
Family LDL receptor-like module 0.0039
Further Details:      
 
Domain Number 5 Region: 681-716
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000921
Family LDL receptor-like module 0.0032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) GSADVT00042155001
Sequence length 1612
Comment pep supercontig:AMS_PRJEB1171_v1:HG380994:58133:62971:-1 gene:GSADVG00042155001 transcript:GSADVT00042155001 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MELNKFIIDLSSAFTKSYYVHKHKKLFEMQRLFSIVMFYCIYATPQINLYFTDSMMSESN
GNLNGLQHSCLRITEIELHTPQSRPITSFCMGESSTQFTIKTDTLLSNYTFAELKKQNIT
SEQLYYWSAPIDIIERYQFYLNQLSITNSLFLGKEIFYNCTLPWFGPLCQYQFDYHHPNH
TSLEHIIRDFYDNNPYKPNNLTCYEHLSCQHTTYLGCLDWTEICDGHVHCLNEATDEKLC
WQIEINECKENEYRCPDGQCIPMLFDANGFIDVHCLDALRYEEKSIRNMHFCSSHQPTIE
CEERRCTDPLFMTSCVQPRVAFLIKLLFSIKDNSTTDDCWSAMKCLIKIPDFNCENICKS
NQCLKIIEQICPNIIYIPSIPILYGTVYHTYINNPSTYFLNTGGSITHMCSNRSLDDYSP
DDLTISLNNVTCYAYVALITSVIPGYPQTTALYDYIDRGILEYNPFKNLTYKMCNRSNIY
RCQNSSKCISVHRLADRIRDCPKFDDEEQNIPENVLLSEYFCRNRFKCPISNTCVPLSII
KVDKCGCGKWYENKCELDYVRQVEEKKSIIFKKICDTKIDLDSINIDGQNKTDETECDQW
PCNNVYTRCDGRWHCPKGDDEVGCDVSFSRNCSSKEHACVSIYTKQIMCLPLEKVNDGNI
DCVGALDEPKLCIEREFSTGGKSFYCETGRLEVCISPMFICNSVKNCINEHDEIFCEKKD
IAPLGLLQGPSGDSTSKHSNMIQVIHNNLEINRFLFGREFVLDNIHDFESYPVDQTNNLT
LFSPEIIQIPRYTEISYCHRGLDLRVWLDRRNNLSTSTCLCPPSYYGSQCQYQNQRISLT
LRIRGSLDTWQTAFVIVVMLIGDDNNNQRIIQSHEQMTYLLMRDCNNKFEFYLLYGTQPK
NPIYHYTVHIDIYEKSSLNYRGSFILPIQFSFLPVHRLSFLIDIPRIYIEIKRCSNLYCK
HGKCIQYMNNFDVSFCQCIPGWTGRHCTIPYSIQCSLDSLSIGINAHNQSICICPLHRFG
PRCLLFNTICQNKVNSTCQNGGQCIPPDDFLMSTQKPSCLCPRGFRGNQCEIAENEIILS
FEKDIRIPQSIFVHFIEIYQENKPRRTTTFKTILIQQDSIILYWSQPFHLIFIELTRQNY
YLISINKTYTRSIKFYKKISSFDHCPHINTISNKQFSELHLLQRIKSYHKLCQTNQSRLK
CFHDELQLCLCYIHTNNQYLVNCFQFNHSMKFDCSGQNHCENNGQCFQDTLDCSRRVICL
CPRCFYGSRCQFSTNGFGLSLDDILGYHISPQLSFRYQSTIVQISIVLMSIFVLVGLIDG
IIGIITFWTKTVCTVGCGIYLLGSSVTTLLVIFVLSLKLSILILTQTLIIKNWLFLSIQC
YSIEILLRICFHMNQWLYACVAIERTITTIKGSRFQRKKSKQMAKKIILILLILIIVTNI
HDPFYRRLIFEKQDDSDNDNDKRIWCIVTYSSQLQTYNYIINILHFIGPFVCNLISSIII
ITNNSRRKFHIQHQQTFKKLLQKQISHHKRLVIGPFVLVILAILRLIISFITKCMSSTNE
SWLFLTAYFISFIPTIVTSLLFIIPSKFYKKEFHTKINRYRTKIQRRLKLNS
Download sequence
Identical sequences GSADVT00042155001

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]