SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for GSADVT00043136001 from Adineta vaga

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  GSADVT00043136001
Domain Number 1 Region: 1238-1534
Classification Level Classification E-value
Superfamily Family A G protein-coupled receptor-like 0.000000000348
Family Rhodopsin-like 0.02
Further Details:      
 
Domain Number 2 Region: 971-1018
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000645
Family EGF-type module 0.033
Further Details:      
 
Domain Number 3 Region: 201-238
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000407
Family LDL receptor-like module 0.002
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) GSADVT00043136001
Sequence length 1539
Comment pep supercontig:AMS_PRJEB1171_v1:HG381005:6556:11346:1 gene:GSADVG00043136001 transcript:GSADVT00043136001 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MFLSGAVSLEYDCLYYVKNDAIIEFDESYDWAHELLTYCIRPDNQSSISNTNQFNSLLFD
QNNYTFAQLEINAVTVTQLFEWSAPIEIIENYQRYLENKDNDIVTRATNTDEKYRFYNCT
PPWFGSRCQYSLMWAASTLELFIDQIFSDAHLSPTLPACYIHLDCNRGSARLCLDWREIC
DGKNDCLNGKDEEQCWELEANQCEENEYRCHNGQCIPLAFQNDGILNPDCMDRTDELKPI
SYPKKCIHDPTFRCEESSCYPIPECIGPNGKCNNNRHLYAQVSIPTTDMNAACWQAMICL
TGQKERNECSCVEGVEIPCISIAAYRCPLDYFIFPKTPIVSNHVYLMYKRPDMSDIGNTI
EPSYVCFDKDLCTMPTTIIHEVLNHTCIDYAEEIGVKLAPYPGWNTMLSILQTVFLKICV
SPMIECPHPSLYRCNHTSKCISIYRLRDGINDCQLNDDEKFTNTCSLNWNNMARFKCSGE
NVCLSMLTIQNGISECLNGEDEMSEFERHLQNYITIQHTSDGIQHLLPIKINGRNETDET
ECGMWKCNNSYTHCNSVWNCPKGEDEVECKNTPIICSPLQRPCILPNTTQLFCLSITEIN
DNYMHCMGGSDERELCRSMYPWKKKRRYHCWNRNECVELESLKECKTEEDTRLWNIIATQ
KRCIDNVMQIRSMSSIKQHLYSNRYTLRKFRRGIFDILDPSLSLQKNSSFSYISQYSLLK
QDLQAATSYSSLPMSLNSDLTRNQISKYIHPASVVKKLKCMCPPSTYGYYCLYQSQRVSL
TVKVRSATDWLSVFTFVFLLITDQNEIESYDYRYYSSITDCILKWNIYLLYRTRPKDASK
NYSIRIYVYKRQATALEYRTSWHYPLYFSFLPVQRMAIQITIPSLTTIIRESICSLACNK
HGSCIVANINTTKKLFLCRCDPGWYGFYCQYAQNSSLTCSCAPNSLCISNYPISICICSL
GRGGPKCWIKIDDCQGLNRCQNGGQCTVYDERQRWYAPICVCPDDYRGPLCEFPLQKFLI
TFHYTIQIPSLVFLHFISYDTYLYKRITSFKKINPYETSATIRTTISNMYLPILFIEYED
KYYVFPFVKDKDKETNIHVHSENRCLSINDLFNSSLVQLHRIRRIKYYHWFCQKHLDLMC
FYDKIDVCLCNDKREAVCIRFDQNTEYICQDDSGNCENGGECFQDDIQCPSRAICRCPTC
FHGSKCQFSTKSFSLSLDNILGYQIRPNSNLRNQLSVVKFSLVFVVIMWFIGILNGIISI
MTFIQNKSCEVGSGFYLLSNSLISILIIILFASKFIILILTQTSHINHKMFLLVQCISID
FLLRTCVNFGDWLNACVAVERALTVIQGIYFNKERSKRIAKWTIVSLFLITASTNLHDPL
NRHLIIDEDEQRIWCIVRYSSFSEAYNSISQILHFALPFVLNIISSLFIIIGISRRRSRT
QKDQTFKNSISKQLILHKHLLISPITLILLATPRLIISLVSGCMKIDRNPWLPLIGYFIS
FIPSLLIFVVFVLPSKAYKTECKNILKSIYHRIRQRAYI
Download sequence
Identical sequences GSADVT00043136001

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]