SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for GSADVT00043709001 from Adineta vaga

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  GSADVT00043709001
Domain Number 1 Region: 514-549
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000072
Family LDL receptor-like module 0.0015
Further Details:      
 
Domain Number 2 Region: 419-461
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000707
Family LDL receptor-like module 0.002
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) GSADVT00043709001
Sequence length 953
Comment pep supercontig:AMS_PRJEB1171_v1:HG381012:115414:118519:-1 gene:GSADVG00043709001 transcript:GSADVT00043709001 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSIDSPGLRLFYLIISILFFDYGLCKNLISDLTLSANLCTNITITNQSFGVIHSFNFYSG
QSQPPNISCSWILTNFQASPWSNYILSLRLIELENDPTHWSNELTFWTGNKQISVDDINK
RTFLLTTSSLKIFFRSRPPLLQTYNPYIRTNLRIRRFLIEFLHVNNDYSNENYFQCRSSG
ILIPKQWRCNCIYECSYDDRSDEENCPLCSMYEPATSLLCQSNEIWCLPKTSRSFSDNLI
DLEYDGDDWVQSHISYSRRIDPKGVCIPRNGYSQCFYSTRTSNCERILAWYQDHGQILLN
KDLLNKNQSLCLIIIAKEEYKIKFISNQYEFFKQRSDLEMIIYDGSEEQNQILTSSNWLL
KKETIQTKDNHIATIVIRKHSIKPISIISDDVLGYLDSNKTHRYIQRRDINSLVLNITWI
TSICPDDQMLCGGNFETKCYTKEQRCDGIWDCISGDDELGCSPESCPTTFACNDHLRLPT
DQPRCYTWSERCNGNAFCANRSDEKLCSNWWCNSNNGTFLCKNLNCIYETWVCDGTDDCG
DHSDETNCPSRVPRRIVTAAVIGATVCSTLFIIALGCTCKLFHLRTSERRATSRLLNPQR
YIEQRRQQIQREQQRRSNRHNRHLNSETTSTIENSLEISNESRRIAPPSYNQTMGLMDEN
EERQAALAEHLRLAGLANYIALPPLLNSSRTSRSTSRHRHRRHRRHRHHHHHHHHRRAHS
EGSRVALLEPNVVIPNNAFPVPSAPFSLNRLRSHLLSFFTTTRSNTTTTTTTTTTNNNNN
RNNSIQSNSNSNQFDTYERQNPSISTQNHPNVLPTRPYSNSDFIQPRELPPPYAEEQLIS
LNPSINSLTTPTTTNSRRSSSGGGSDIEANNRSTSNSSLYRIRKRQIPINTLRDRMRQFI
SGTSAVRLTTDDSTHPMQPTTTTINIDLQEQPPVTSMEDDETHSSDDDKILTP
Download sequence
Identical sequences GSADVT00043709001

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]