SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for GSADVT00044901001 from Adineta vaga

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  GSADVT00044901001
Domain Number 1 Region: 1223-1511
Classification Level Classification E-value
Superfamily Family A G protein-coupled receptor-like 0.0000000000000421
Family Rhodopsin-like 0.029
Further Details:      
 
Domain Number 2 Region: 951-995
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000128
Family EGF-type module 0.028
Further Details:      
 
Domain Number 3 Region: 201-237
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000317
Family LDL receptor-like module 0.0016
Further Details:      
 
Domain Number 4 Region: 872-921
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000479
Family EGF-type module 0.035
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) GSADVT00044901001
Sequence length 1522
Comment pep supercontig:AMS_PRJEB1171_v1:HG381026:149005:153573:-1 gene:GSADVG00044901001 transcript:GSADVT00044901001 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPQINLHNSDWTSNPENNNILQHDCLRIDILNEKGNISREIMFYCMSELPSKFSIEIDDI
FSKFTFEELSIENITSEQLYLWSTPIDIIENYQFYLNELSLFNKSSLSQEVFYNCTFPRF
GSMCQYEFDHYRPQHSSFMEIIDDFYSTYQYKPINFTCYIHLECHHEHSPICLDWTDICN
GRIDCFDTELDEKDCWQLEINECHDDEYRCINGQCIPKSFVLDEENFPDCLDRSDEYIGA
YNENNGCNQEKPSFKCEDVRCQAKTWIDSCWSQRDRAILMNMFSMKDNTTSDQCWNAFLC
DAIELHKPSFSNCAHSCENKPCKKIIELNCPDMISMPIIPILFGDIYFAYEKYNSTMKDS
NEYKYPYLCYNNSRYDRYFKELSKNFGNYSIVKFNNRMCHRVIIPFILGQVSVHSITRIY
LSLILRHDLWQYQQVYNYNSIICKRSNMYQCINSSKCISIYRLKNSIRDCPNSDDEDEIS
LNHTVFLTEPMNWDREEMKLEYAKTHISFQTICDGFTELIPIKINERYETDETECEHWLC
DNIYTRCNGILNCRNGADETNCHISSSNCSSNEIQCVSPITNEFICITTKQVNDSHIDCL
GASDEPALCRTDYQVINTKNFYCINARFEPCIEYSELCNDDKLCLQGEDEQFCTTTKKYS
FYSICWAEERINATAIEHFLCNQMQGYSKERIIYFTLNNTIEKIEDKTKYNKKHADFLPS
ISIDNCHRGISMRLWLNKNTTRTICFCPPSYYGSQCQYQNERISLSLRFQVSPNSLQMPF
EILILLIDNDNIIHSYEQFTYLSIRDCQTKHSVYLTYANRPKLQSKTYEIRIDIYEKFPL
NYRASFLYPIQFLFLPVYRLSLLIYIPNNDQNIESCSINPCQNGQCRKYLNNKQKTFCQC
DKHWSGRYCTIQHSTICSNDSLYIDISSTNRSICVCPMNKYGSRCLLENTICEKFACQNN
GQCIPTDKYELIKKNLTCICRKGYTGEYCEMNDTKIIITFDKNIHLSSSIFIHFIEIRKQ
SNPLRSTTFQTISIQEEFITILWSRLFHLIFIEFYFNDYYLVTIENNSSQTKEIIQTITL
SNRCYHINEIFNQSIIQLNHIRRIKYYHLLCQLNLSCFYDHIHLCICYQFNQQRLANCFE
FNHNETYDCSGQNDCQNNGKCFQDTPICPKKSICSCASCFYGRLCQFTTSGFGLTLDNIL
GYYIQQNVNILQQSSIIQVSIGLNVICILIGFINGILSLITFKNKNIREVGCGLYLFYSS
ITTLLIMILFALKFWILIFTQIYLIKNRLFLQIQCISLDFLLRVCLNMDQWLNASVACER
VMTIIKGARFVKKKSKKIAKLIIPSLLLFNILTSIHDPIYRRLINEENNDNNEKRIWCIV
SYSSHLQIFNNITNTLQFFVPFLINLISATILLIMKTRQQSNFQTKRTVSEILRKNYRQH
RHLFLGPVLLVILAIPRLIISFTSKCMKSNHDAWLFLMGYFISFIPPMLTFIIFILPSKF
YRTAFHKSILQYQHTIQRHLQF
Download sequence
Identical sequences GSADVT00044901001

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]