SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for GSADVT00044942001 from Adineta vaga

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  GSADVT00044942001
Domain Number 1 Region: 1251-1544
Classification Level Classification E-value
Superfamily Family A G protein-coupled receptor-like 9.06e-16
Family Rhodopsin-like 0.011
Further Details:      
 
Domain Number 2 Region: 637-675
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000236
Family LDL receptor-like module 0.0015
Further Details:      
 
Domain Number 3 Region: 987-1031
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000234
Family EGF-type module 0.019
Further Details:      
 
Domain Number 4 Region: 457-493
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000157
Family LDL receptor-like module 0.0041
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) GSADVT00044942001
Sequence length 1563
Comment pep supercontig:AMS_PRJEB1171_v1:HG381027:151456:156147:-1 gene:GSADVG00044942001 transcript:GSADVT00044942001 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MFQLINLFYCVLIHLTVATPHINLYYTNWTNNNDNNGSQHDCLRVLTLIKESQDHHQIVL
YCIDELPSDFHIEKKNVLFEKFTFDELSKQRITSQQLYDWSTPMDIIEDYQSYLNQLSTS
SSLATRVFYNCTLPRFGSMCQYELYNYHENYSSLYEIIYDFYHKREYNPEIVTCYTHLEC
YRGPYPSCLDWSEICNGKVDCLDGEFDEEHCWQLEMNTCQDNEFQCPNGQCILKSFIQDN
INDSYCLDEVDDYYRLSLGLTLCEKTEPSFNCDDIRRNDKFLTSSYFSQRESILLRAMFS
VKYISISDDCWFSFICKIYWDLLGASICQNYCFDDECNEVIERECPDMMFIPAIPVLFGQ
IYFAYRKNHSKTSNNLDNSDFGYPYVCYNNSIYDNYFINSSKVYFNNTICYYRQNRLFLY
HSTHGWDKQYLLPYYRDLWEYHYMSKYNQSSNYISRMCNNSDIYRCNNSIQCISMSKIMD
NIIDCPNGDDENILYVSHIILPDQVTSAFYAYPENIKVMFRYVRKHILFQTICDGFVELA
PILIGEQNHTDETECEQWQCNNIYTHCDGLWNCLNGADEIGCNSFSLLNCSPNDHICVSP
HTNKFMCLPITKANDGNIDCIGGSDETLLCQRMLYVLYNRNNFHCIKGNSGYCIPFFYLC
DGDQDCIDGSDEQFCEKNRTYQELDVSICQPSVLPFASDIEQFICNRMKIFVKQHLIYFS
LGRMDNKIEDKSKNIENNILLNPIMNKISEQVQYNCNRGVVLHVWSNNENNSRRITCLCP
PSYYGNKCQYQNERISLTLQIRVLFDSFQIPFSIIILLIDNTDQRIIHSYEQLNYLSIKH
CKMKSNIYLTYSTRPKDLKRNYSIHIDIYERISLTYRGSYLFPIYFPFLPVHRLALIVDI
PHKDDKNIQTCSNNQCNHGKCIKYLNNAENITFCKCDREWFGKYCNIQQFCQCSNDSLCI
GVLPNNRSICICPIDKFGSRCLVPSSICQNSTCQNDGQCIPNDNYMIYNQKFICICSKGF
IGDQCETVDNKLILSFEKSIIRSQSIFIHFIEVVKNNIPNRATTFKMISIRQDSIIIYWS
QPFHLVFIELFHQNYYLGVHQTIYNQSTTIIKIINPSDHCQHISKLFNESFAKLDLIRRI
KYYHLICELYSSNLKCFYDDIHLCLCYDFNQKRLANCFEFDHNMKFNCLEQNVCENDGQC
FQDHPNCPHKSICICPLCYYGTRCQFSTSGFDLSLDAILGYHILPNINIIYQPVIIKISL
TLTIIFIVIGLIDGVLSMITFKTKTILEVGCGVYLLGSSITTLFIMIIFGLKFCILLLAQ
ITIISNRLFLKIQCISLDFLLRVCLNMDQWLNACVAMERAITVIQATRFNKKKSKQGAKL
AIIILLVINIGTSIHDPFYRRLIDEENEDEKRIWCITTYPSGLNTFNSIINTIHFIVPFL
INLISAVILILKKSRQQANVQTNQTYIELLRKQFETHKHLLTAPIMLVILALPRLLISFA
SKCMKSSNDAWIFLIGYLISYIPPMLTFVIYILPSKVYKSQFHKNVAEYRTNIQRYLNIT
VRR
Download sequence
Identical sequences GSADVT00044942001

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]