SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for GSADVT00045046001 from Adineta vaga

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  GSADVT00045046001
Domain Number 1 Region: 58-262
Classification Level Classification E-value
Superfamily Sec7 domain 2.35e-61
Family Sec7 domain 0.0000105
Further Details:      
 
Domain Number 2 Region: 264-395
Classification Level Classification E-value
Superfamily PH domain-like 0.0000000000085
Family Pleckstrin-homology domain (PH domain) 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) GSADVT00045046001
Sequence length 488
Comment pep supercontig:AMS_PRJEB1171_v1:HG381029:69418:74507:1 gene:GSADVG00045046001 transcript:GSADVT00045046001 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSLQSLSSESNSGSLSNRLSSNSIEFHQQQQSLIPQDQIILQGNERLSTIRSNETYRRRC
YRAGLNIFNKKPERGIHYLIAHRFLDSNPQSVARFFLSRKGLSRQMIGEYLGNLQDPFAM
QVLHAFVNEFDFHDMSIDVALRKFQSSFRLPGEAQKIEQLMKVFGQRYYATNSSSSFSNI
DTIFILAFAIIMLNTDLHSRNIKPERKMRLDQFIKNLREKKKILISTIKSIDDGADLDIN
YLTGIYERIRADEFRPDNDHVSQVLKFEQGLVGKKPTLTAPHRRLVCYCRLYEVCDVTKR
EKLTAHQREVYLFNDLLVVAKLSGKKHQQFRQVFRLSAMNVYLFQTSYHQYGIRLVRKSD
TNEINLILFNARNEHDRTKFCDDLKEAILEINEMDGLYRQAELDQLRASSNSLVDITNHH
GILSSLIDHPTIKRDRPLSRTLSNSLLDMALPINNHQSLPCRTSQCSLDSGMISLTNEVS
PNNRILMR
Download sequence
Identical sequences GSADVT00045046001

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]