SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for GSADVT00045883001 from Adineta vaga

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  GSADVT00045883001
Domain Number 1 Region: 1320-1383
Classification Level Classification E-value
Superfamily Serine protease inhibitors 0.000000000343
Family ATI-like 0.032
Further Details:      
 
Domain Number 2 Region: 1420-1457
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000249
Family LDL receptor-like module 0.0017
Further Details:      
 
Domain Number 3 Region: 1459-1493
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000982
Family LDL receptor-like module 0.0014
Further Details:      
 
Domain Number 4 Region: 960-1017
Classification Level Classification E-value
Superfamily Serine protease inhibitors 0.000000245
Family BSTI 0.035
Further Details:      
 
Domain Number 5 Region: 1622-1657
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000432
Family LDL receptor-like module 0.0026
Further Details:      
 
Domain Number 6 Region: 482-544
Classification Level Classification E-value
Superfamily Serine protease inhibitors 0.000000589
Family BSTI 0.034
Further Details:      
 
Domain Number 7 Region: 1497-1536
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000825
Family LDL receptor-like module 0.0016
Further Details:      
 
Domain Number 8 Region: 1546-1583
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000089
Family LDL receptor-like module 0.0019
Further Details:      
 
Domain Number 9 Region: 1678-1702
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000157
Family LDL receptor-like module 0.0024
Further Details:      
 
Domain Number 10 Region: 857-918
Classification Level Classification E-value
Superfamily Serine protease inhibitors 0.0000213
Family BSTI 0.04
Further Details:      
 
Domain Number 11 Region: 1583-1622
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000327
Family LDL receptor-like module 0.0024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) GSADVT00045883001
Sequence length 1743
Comment pep supercontig:AMS_PRJEB1171_v1:HG381041:36939:43567:-1 gene:GSADVG00045883001 transcript:GSADVT00045883001 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MFSYSSLLSALLFSIHLTNFLVTAQISGTNICTTTVTETKNNTCPDGSTFNIMAEYEKPA
GIWRIDFNTLRTVQGLKDADDVIRYIKSQSAANASCPYQRQVSKDACCAGWTGESCNVAI
CTIPCKNGQCIKPDQCFCNNGYAGEGCQYQQNDPRLVLCYRTSSCNVPSRISNGTVTASY
CCENLAGVAIGSTDGTCSLCNATNEEIANATAQIKRTLTYATCLLWGRDHFRTFDGFTYD
FQGSCQYKLSGTSSWTVVVQSVNCDQWTTCKKSLSISFGGYTITATGRKVIVNNVALNDN
QGYVDGPLTIERRSGDYTYLRYSDGVRLKWDDGMTVAVTIEQTYMKQVTGLCGTYTNNRD
DDLQLPDGSLSASATHFANEWRTDSGCPTSPVPTDPCTADLIDAAEDACRPIISPYDSFK
ICNRVLNTTPIYETCKRDHCVAAKYGINAQEQAVCSSFEAVGRDCEDNYMHIDWRTTDRC
PKSCENAKIYTECATSCPSTCQNHRQQFTDSVDCKKDCSPGCVCPSGSVIDIGRNGTCTK
VEQCTCRAEGKYYLAGASIKVDCNECKCVTGTWSCTKKYCSRTCSVLGTNHIQTFDGKFY
SVRGNCEYILVEVKDHLFLYIEINPSVGLYVAMTNSYTSTSNYKDLTVKCNQTYVYIKDK
NVQINGEIRAILPYKNVEVTVTRETTVFHTITCRGAQIQFDGIRVYIRLDPTHVNNTRGL
CGTFDFNRDNDFSIRTQIVDTNTQSFIDEYKTNTACTTPNQDDPCTINGNLQSGAISTCS
ILKSSLFQACASKIDPSPFFQSCQYDLCSDKNSHFQNTFVCAAAAAYARECRLANITINW
MSDANLKLKCQDAQYGQCSGGAAYSDCAPKCSQTCHDISVVNQSCYERECMAGCSCPSQS
YLDVSVSDKPQCVPQSGCACYDFETNTYIKAGQTVARSCGNCTCTNGKWNCGSQSCEAAT
TCPETQVYSYNATACVKTCDNMKTWRDCGLTYEGCTCPDGKVLSQDLKTCVDVTACPCRY
AGRSYGPGQSVKSGCKDCKCSAGSWICTEQKCGATCSASGDPHYVTYDGNYYSYQGNCKY
VLTQTKDLSFRVITENVQCGTSGVTCAKNIFIKCKGLTVSLTRGRDPIVGDVEVKDLDLG
HRVFGDVSLMKSGLFVFVNCSEIIVKWDEKTRIYVTIPYTMKGQTAGLCGDSDNDPTDDL
NTASGVPGTITDMAESWKVEQTCVTGPSPVVDPSAPCAGFEARRNWATKECSLVKTNPFL
PCIEKLDATVVQDYYRNCLYDACHCDTGGDCECLCTSLSTFGEKCQSIEVPVKWRTQDRC
PMQCEYGKIYMACGAICQSTCRDIYLKDDYSCVESGCHEGCFCPEGQVMDETGTCVEPDA
CPCIDNNIPYSVGTKLIRNCDQCTCTNGTFLCVPLPNCVPKCSRNEFTCNSTGVCIPLSH
VCDKISDCDDESDEFNCGCTPNDFICDNGQCVNSTKRCDNLPNCRDGSDEFNCNETYPCY
GFRCDNGKCIDRSWVCDGHVDCTQKGVFDNSDEHQCNHTECDTESGRAFRCNDNPMSKCL
PIEQRCDTHDDCGDGSDEKNCTCMCTDNKFACTTICDCIPVANVCDGIEQCRDGSDEKNC
LCNINEYTCNGGGCINMTKLCDGVPNCPKNDDETHPNCSNPGTTTSVCTTKLCLVSNVYH
CIPEEELCDGEKDCDDGSDENPQLFPNYPRCQIQSMIFQYFSCIIFLYFFLTRYSTSMHT
IYL
Download sequence
Identical sequences GSADVT00045883001

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]