SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for GSADVT00046076001 from Adineta vaga

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  GSADVT00046076001
Domain Number 1 Region: 1147-1439
Classification Level Classification E-value
Superfamily Family A G protein-coupled receptor-like 0.000000000439
Family Rhodopsin-like 0.026
Further Details:      
 
Domain Number 2 Region: 876-920
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000101
Family EGF-type module 0.014
Further Details:      
 
Domain Number 3 Region: 125-164
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000632
Family LDL receptor-like module 0.0015
Further Details:      
 
Domain Number 4 Region: 488-535
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000785
Family LDL receptor-like module 0.0082
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) GSADVT00046076001
Sequence length 1447
Comment pep supercontig:AMS_PRJEB1171_v1:HG381044:43343:47725:1 gene:GSADVG00046076001 transcript:GSADVT00046076001 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLRWSAPIDLAERYAEFLTQNTHSLSMNEVFYNCTSPWFGPYCQYTFGFHPSTFSFEDVV
KMTYESKKESTERGIGNDTNLPYYTHIKCKLAGGKYLDWREVCDGKTDCLDSNEDEEDCF
ELEINECMHDEYRCYNGMCISADFFRDDPFHPECLDGSDERNLLMNNFRDCYLQPSFRCE
ERSCRHPMKQFPCGDGQCTNRINTNYIFLWFGLCVNNPNPTLPFECWFLITCIQVWTSSC
RRLCTKRNICHKKVKNLCPPYFFFPTYPIYDNHVRYAFLNNLAFHITHLDLVPHYICYDK
ERCPFLTASISIYGFSCIETQHFVKLGYEDVSELFHTCVSVDALSLNAVARFQRYDLYNC
PDTLKYISKHRLVDGISDCFGDYDEIYNESCSLHDKHRIRCSKDFDKCIKSITVFDRKKE
QCNYVGEDYDSIKREISFPTICNSYWEIYNQFSFQVDDETDESNCQWWPCNNQYTRCDTS
WTCMNGADEWNCPYSTCPYNHIMCVSPQTLTTFCLNISRIGDGVIDCLGAADEQAYCRTL
TGIWNMRYRCRNSDHCTFLDHQAVPGHDCRAEDTNYTEANALRLLSTFWLLNPPYSHFGL
NSLPLTVTSQSFEQTRSSSSEKSALHDSYLSPVTNSFPKTMDARTLNSQEAWLCNRGILI
LKGFDRKQSCLCPQSYYGDRCQYQSDRVSLTLQFRRDAAPDDIREVFTVVIALLDNTGVI
HSIDYITYLPRTTCNAKFNRYLLYDSQPKDRTKNYTVRVDAYNRLNVVHYASWLLPVKFA
FLPVNRMAFHLTIPVRQTSLSKECRFTCIHGYCTKYVNELELPYYCQCYSGWSGARCTIP
LSCTCAEGSLCTGVTRNRSICVCLPQQIGPRCFLRSSCLASTCKNGGVCVPADERSSLRD
NFTCVCPKGFWGVNCELTETKITISFASEVKIPLFIMAHFITVNKNADPTRLTTVKKIPI
DFDEVTLSVSKSFTLLFVQIQSNFYLAYVQMNSTLISSITISSKITRAHQCPHIRQLFSD
NATINYSLLRRIKYYHIPCGERYALSCFHDEKDFMCLCNEHRHANCFKFDFNITYNCWGT
SECQNGAACLQDDRNCPAETLCACLECYYGSKCQFSTSGLTLSLDAILGYQIRPHLPIHR
QRRSVQVSVGLSILILVIGIISGILSSMIFLKKTVREVGNGIYLLVASINSILTLSMLCF
KFWFLLLAHMSVITNRNFLSIQCIVVDFTLRFLLAFGDWLYACIAIDRVINTRKGVHFDR
KKSKKMARWIIFILMLMIVGSLIHDPIHRELFYDQEEERNWCIARYSSVTKILDSIITMA
HIILPFIINLISAIIIIIAIARQYSAVRKQQTYKEHLRQHFRERKHLIISPLIIVLLCSP
RIVISFLTGCIKPGRDPWLFLASYFISFTPPLLIFVIYIIPSEAYMRVFIKTVVHMLQRR
VFLKTKI
Download sequence
Identical sequences GSADVT00046076001

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]