SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for GSADVT00046319001 from Adineta vaga

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  GSADVT00046319001
Domain Number 1 Region: 1153-1455
Classification Level Classification E-value
Superfamily Family A G protein-coupled receptor-like 6.87e-16
Family Rhodopsin-like 0.019
Further Details:      
 
Domain Number 2 Region: 893-933
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000237
Family EGF-type module 0.01
Further Details:      
 
Domain Number 3 Region: 139-178
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000421
Family LDL receptor-like module 0.0013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) GSADVT00046319001
Sequence length 1463
Comment pep supercontig:AMS_PRJEB1171_v1:HG381047:136165:140998:-1 gene:GSADVG00046319001 transcript:GSADVT00046319001 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MYTIDETISTKISFKELKQKNITSEDLFQWSLSSDIVEEYEIDNNENFLYNCSLPWFGSK
CQYKFPYDLSMTFNEIVYETFVRRSSDSSIKTGSCYRFIDNCNDDLWPMCLDWREICDRK
PDCPNGEDEQFCEELELNQCTENEYRCHNGQCIPFEFAFESVTSVDCLDGSDEIDYYAIA
NHERTARFSQQFVCGDGQYSAGSYMPSTRLFCKNNRDQERSKQFFTSLNHIDDENCREAF
YCKIIHSNNSSMIKNCEPLTKKCSSEWLVLPKRPNMFGFLQFIYFTNRSVEEFKENIQPD
LICFDIKNCPVLKGQLTTTQIINELPCSHAYNWTHFHQMDDFFQFLWAFPDIAHECLTTS
TENSCNNSFQFYCFESRKCISYHRVGDGHRDCYFNEDKSMPACSFNDSMRFRCEELDNNE
CLSPVAIGDGFRDCRNGRDELIKSKQDFNKTDSYSKLCLDRGAQNMPGVPNKDTSYCEFW
PCNNPYSYCDKVWDCPNGIDELNCSYSNCSSDKHQCYDDQSDLTYCLSINQLVDQIYDYC
PSSASRLIYFNNKSIINENKYYSWNNSKCLNGDKLCCHGQSSSSIIVDENICLYDKRIPL
ISMNGHIMLFNTNKYMCKLPLEYSRIDKSEYLTSFRMGNFPSLNSSLSTVKYISRIEKQK
NIYYPMNITQTWFCNRGILIFSRRNQTKKCLCPPSYFGSQCQWQNQRISLTLQFISPRTT
FITAIFQVIIMLINEQNEIFDNHEQILFLPTRDCGTKFHLYLLYPQRPKLSSINYSIRID
LYDKTTLKHWTNWFLSIPFQFLPVNRISTKLLIPKERLIKSCPLSCGQYGQCMIYTNIDS
KYFCQCHRDYSGPFCNISSQCSCSNHSFCLSSNICVCPLNRFGSKCYLKRSICSAEHNPC
QNQGLCIPTDDRINLQGYLCHCKEQYFGQNCQDSSSRIDLELDKTILTTSSAVFLHFITT
FQYSKHEQTTLLKKIPLHENIITFYISKQFNLIFLQLLNQSYYLAIVPIVREKSIPLENI
QGQISLQQHCPDVKQFLNSTLLKLESKLYPYICRQRRYLMCFYDERLMCICDNDRFANCF
EFNHTIDNDCQGHNDCENNGECFQNNQTCPTTSICICKDCFYGGKCQMSTEGNLLSLDPI
IGYFIKPTKSFSSQPSIIKITMGITFMIFLFGLIDVILSILTFHMKNPREVGCGYYLLTS
SIISLFMIIFLGIKYLHLIFSQMKIIDNEFQLLFGCKIIDMILKSLLASNEWIIACVAIE
RTINTINGPKFNKMKSRQLAKWIISFVICLTFLSHFHEPYYRQLIKDDDGDNERIWCFAR
YSSFIDNYNYFITLLHFLGPLIINIISAIIIIILVSRSRSNAQKTKSFSEHFKEQLIRHK
HLLISPLTLVLLGTPRLIFSFIRGCMRTTRDPWFYMIGYYISFVPPILTFSTFVIPSTNY
RKEFRSAIQKQLIRFQSTFLSGH
Download sequence
Identical sequences GSADVT00046319001

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]