SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for GSADVT00047366001 from Adineta vaga

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  GSADVT00047366001
Domain Number 1 Region: 36-149
Classification Level Classification E-value
Superfamily Sec7 domain 0.00000000000000183
Family Sec7 domain 0.00081
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) GSADVT00047366001
Sequence length 168
Comment pep supercontig:AMS_PRJEB1171_v1:HG384273:857:1515:-1 gene:GSADVG00047366001 transcript:GSADVT00047366001 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
KYFGFSTLCKSNWGYSSVYKRAQNEGISFRKIYLQLDEGTLRFNAGQGLQYFIENRLLDD
DCEEICQFIHNTRKLRAIEKRKLLQTRRDILERLIELQSYENQFLPNALRQFFSKLDAPE
DRNEYLSLLIENFSKRFHDCNRGLGLSIGTFIYHFQKTNSLSNLFFLL
Download sequence
Identical sequences GSADVT00047366001

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]