SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for GSADVT00048356001 from Adineta vaga

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  GSADVT00048356001
Domain Number 1 Region: 1179-1491
Classification Level Classification E-value
Superfamily Family A G protein-coupled receptor-like 0.0000000000000238
Family Rhodopsin-like 0.018
Further Details:      
 
Domain Number 2 Region: 928-970
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000873
Family EGF-type module 0.0089
Further Details:      
 
Domain Number 3 Region: 169-209
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000477
Family LDL receptor-like module 0.0011
Further Details:      
 
Domain Number 4 Region: 696-738
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000978
Family EGF-type module 0.048
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) GSADVT00048356001
Sequence length 1499
Comment pep supercontig:AMS_PRJEB1171_v1:HG381070:126221:130853:-1 gene:GSADVG00048356001 transcript:GSADVT00048356001 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDDQLYTSAPYIRNYYLIPYCRRPDHLEEEHSIDFIDENMVKKMNSRELKQQNITGNDLL
NWSLPIDVVEEYEMKNESVFFNCSLPWFGSKCQYRFPYDISMTFNEIVSETFHRRSTESL
TTGTCYRFIETCNDDLWPLCLDWREICDQKVDCPNGEDERRCEELELNQCNQNEYRCHNG
QCIPLKFAWESLTSVDCLDGSDERDIFRSVFAGEPSSYNHNCLNLPIFRCEERTARYPRQ
FVYIEVIRRLFTSLDHIEDEKCRDAFYCVLHSNRNLRKKRFLHCYFLLLKYCEFLRDKCS
LEWLFLPKKATMFGIFQFIYFTNRSIDEFKQNIQPDLTCFDIDKCSVLTDVVVNATIING
LTCILTSILTQYDQAFNFDHFIGSFREVLRQCLTKGTDTSCNNSNEFHCSQSMKCILYNR
VQDGYPDCYFKEDEKYSACSLNDSSRFRCRMKTNLCLSPVAISNGFSECGGDEDEKIHQK
QDFNKTASYSKFCLGSAAQYLAGLGYIDKQNKYCDLWPCDSPYVHCDKIWDCPNGIDELN
CSYTNCSSNKHECQDDSLGSTYCIPISQIVDETIPFCHNGVSRSLYFINGSTIDENKYYS
WNKTKCLYANNICRTGIIFPITVDEDACLYDRNLPQIRGGHSVMSFDTRRRLCDLKIDTV
HQRKERFLTAFRLGNFPVVTSLSSIKHISIIDEEKKKYIPMNISQTWFCHRGILVLSGNN
QTKTCLCPPSYFGSQCQLQSQRISLTFEIISPRATFITDSFQVIIMLINEQDEIVGNHEE
ILFIPARDCQTKFHLYLLYPQRSKSLSNNYSIRIDLFDKITLKHWTSWYLSIPFQFLPVN
RISTQLFIPKEQTINVCPLFCGLHGQCMYYTNNEVKYFCQCDQGYSGSFCNESYQCQCAE
NSFCLSPTICICPLDRFGSKCYLKRSICFSINNPCQNEGLCIPKDGRIDLHGYSCFCKEH
YFGLHCEHSSSRINLMLDITIARTSSIVFIHFITTFEHAQHERTTIMKKIPVDSNTIIFS
VSKQFNFVFLQLLNQSYYLVIVREIFIPSENIHSEILSKQHCPYVKQFLNSTFLEYEQFY
HPSFYPLVCRQNLHLMCFYDESLLCICDLDRFANCFVFNHTLDNTCQGHNDCKNDGQCFQ
NNQTCPTMSICACQNCFYGGKCQMSTEGNLLSLDPIIGYYIKPNASFYHQPLIIKVTMGI
TLLIFILGLIDVLLSILTFHMKNPREVGCGYYLLASSIISFCMIIMFGIKFLYLILSQMK
MIKDEFQLLFACKSIDMLLKSLLASNEWIIACVAMERVLNTINGPSFNKRKSQQLAKWII
PIVISSIFISHLHDPYYRQLIHDTDEDEKRIWCFVRYPSMIDTYNSFITLMHFIGPLIIN
TISAFLIIIFVSRSRSNIQRNKSFHQHLQEQLKRHKHLLISPLALVLLGTPRLVFSFVSG
CMRTPRDSWFYVFGYYFSFIPPILTFPAFVLPSSNYRKVFQSAIQQQLIRFQSTFLSKF
Download sequence
Identical sequences GSADVT00048356001

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]