SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for GSADVT00048552001 from Adineta vaga

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  GSADVT00048552001
Domain Number 1 Region: 149-215
Classification Level Classification E-value
Superfamily AN1-like Zinc finger 5.23e-25
Family AN1-like Zinc finger 0.00026
Further Details:      
 
Domain Number 2 Region: 10-48
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.000000000513
Family A20-like zinc finger 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) GSADVT00048552001
Sequence length 220
Comment pep supercontig:AMS_PRJEB1171_v1:HG381073:98226:99167:1 gene:GSADVG00048552001 transcript:GSADVT00048552001 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEQPESNPTFCTNNCGFYGSSQFEGMCSKCYRDHVSRSLNTGRTNSCNSYYASSNTPVTS
SSQTLLPNTSTNDAQQMRDDQDEVIGRMDEDNDLPQMESTVNQMDDDNSESPLATDEQSP
TTKEDSDQPIDESSASHINPGSMSPVTASSVDKKKRNRCTWPTCNKKLGLTGFDCRCGGQ
FCPLHRYANEHNCTFDYKEHGQNEIRKNMPVVQAERVRRI
Download sequence
Identical sequences GSADVT00048552001

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]