SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for GSADVT00048600001 from Adineta vaga

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  GSADVT00048600001
Domain Number 1 Region: 434-532
Classification Level Classification E-value
Superfamily Mannose 6-phosphate receptor domain 7.98e-18
Family Mannose 6-phosphate receptor domain 0.0086
Further Details:      
 
Domain Number 2 Region: 220-283
Classification Level Classification E-value
Superfamily EF-hand 0.0000397
Family Calmodulin-like 0.08
Further Details:      
 
Domain Number 3 Region: 77-116
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000511
Family LDL receptor-like module 0.004
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) GSADVT00048600001
Sequence length 547
Comment pep supercontig:AMS_PRJEB1171_v1:HG381074:51288:53606:-1 gene:GSADVG00048600001 transcript:GSADVT00048600001 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSSVYINLVLISTLLTLVLSGNVEHVILRGIPTSQLPKYVSSKPFSCLDGSSTIPFEFVN
DDYCDCRDGSDEPGTSACPNGRFFCENKGYVGTIIPSHFVGDGVCDCCDGTDEYETKIVC
NNTCFELAQKNQAEREARRALHAAGVAKKLEIITQSVVIKADREERLKEFEQNLQKLESE
LKEKEELKNQAEAPENEAKEKHQKLWEEQRAIREAIARDNQMREMFAELDTNNDTLVSID
ELQKHPELDTDHENEFTVDEVRSILGADSVNFEEFNVTVYEQISNSYKKLQEPASEIPVD
LNDIAASTEAYLKQKEDKEVEQQEQEQEQEQDQHHYEEETPNHEDDEEHDFDQHENPSPM
ATSLEHEKHIHDDTVPEYDDETKRLIQIADQARNEYNEIERRVHDMKREVDDLKRQSDVD
VGVHGEYAAFIDQCYDYEEREYTYRICMFKDAKQIPKGGGGDVTVGYWDSWVGPADNKYL
KMKYSNGATCWNGPARSLTVTFRCGIEHKPVDVREPTRCEYAMIFETPSACDEKIASATL
HHGHEEF
Download sequence
Identical sequences GSADVT00048600001

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]