SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for GSADVT00049034001 from Adineta vaga

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  GSADVT00049034001
Domain Number 1 Region: 187-252
Classification Level Classification E-value
Superfamily AN1-like Zinc finger 4.06e-25
Family AN1-like Zinc finger 0.00026
Further Details:      
 
Domain Number 2 Region: 10-48
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.000000000656
Family A20-like zinc finger 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) GSADVT00049034001
Sequence length 257
Comment pep supercontig:AMS_PRJEB1171_v1:HG381082:29933:30872:1 gene:GSADVG00049034001 transcript:GSADVT00049034001 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEQPESNPTFCTNNCGFYGSSQFEGMCSKCYRDHVSRSLNTGRTNSCNSYYASSNTPVTS
SSQTLLPNTSTNDAQQMRDDQDEVIGRMDEDNDLPQMESTVNQMDDDNSESPLATDEQSP
TTKEDNDQPIDESSASHINRVVSAPTMPIVISRNIDIPGKNESNISFSVMETSSLGAGSM
SPVTASSVDKKKRNRCTWPTCNKKLGLTGFDCRCGGQFCPLHRYANEHNCTFDYKEHGQN
EIRKNMPVVQAERVRRI
Download sequence
Identical sequences GSADVT00049034001

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]