SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for GSADVT00049195001 from Adineta vaga

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  GSADVT00049195001
Domain Number 1 Region: 8-42
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000275
Family LDL receptor-like module 0.0042
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) GSADVT00049195001
Sequence length 221
Comment pep supercontig:AMS_PRJEB1171_v1:HG381084:57248:58086:1 gene:GSADVG00049195001 transcript:GSADVT00049195001 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKPSLNPTCDGGNRTLRWSQFCDGVFDCRDHFDEEGHFCSKFKLIIYLFFPIQHYQFFIF
FEIELCINNLYSCSSKDELRCDLACKALQYVPCQTIQDRRACLRLQQNYDNFSPYRLLTD
INFYIAVAIATIIILLVATGITILIKYFIRTQRQRIMRFSSKTLNLPTAPPAPPPPYLST
PHRSIERDTLSNHIYEQCYEPPPYKDAHKYPMTRTYYEHVL
Download sequence
Identical sequences GSADVT00049195001

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]