SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for GSADVT00050901001 from Adineta vaga

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  GSADVT00050901001
Domain Number 1 Region: 1296-1586
Classification Level Classification E-value
Superfamily Family A G protein-coupled receptor-like 0.00000000421
Family Rhodopsin-like 0.01
Further Details:      
 
Domain Number 2 Region: 1029-1073
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000335
Family EGF-type module 0.015
Further Details:      
 
Domain Number 3 Region: 949-989
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000016
Family EGF-type module 0.025
Further Details:      
 
Domain Number 4 Region: 596-630
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000327
Family LDL receptor-like module 0.0035
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) GSADVT00050901001
Sequence length 1603
Comment pep supercontig:AMS_PRJEB1171_v1:HG381113:113195:118006:1 gene:GSADVG00050901001 transcript:GSADVT00050901001 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MMLILLKIFFDFMIICLHVSSYEINLELTDWTSNIDEINMDLQHDCLYISMSIEPQTISW
HLEHYNITRNFRQMTSLCLTEWPSTWKIQDNTQDQQFTFSRLADLNITSLQLYYWSAPID
IIESYQFYLNQLSTSNDISLSKTIFYNCTSPRFGPQCQYSFPFRTKQKLSSVHELIHRFY
IALGYPVDDLICYDHLQCYFGSTLLCLDWNQICDGFIQCTSGIDENYCWQMEINECKENE
YRCRNGQCIPLAFFDDNPIAAECLDRSDTKEKFDWNIELREKFDYLRPVFLNEEVLIFNG
TAHFGSYFEVRNRRAFFVHYMMLEQTHSMSNTCWLSLYCYLGFEIQMDKICHEICSNEHC
QEMMNESCADMFYLPSVPIAFGHIYLAYSKQYLIQQKIWTNAPEYICYNEQLCGGFNSNE
EILYFNNSLCRRVQDILPNVISDRDAIQMIWNYIHQVSMYLTKCNTILQNDTIICDNQTM
YQCLNSSKCIGKIRIFDQFQDCDYGDDEDIQNKILINEICLNEQSSTHFICPNTNKCISR
KLIRNSQCDCEYLDIEHLICPDEDIEKKSIREIISFPTICNGFNDLSPIIIDGQNYTDET
ECDQWICNNPYIRCNGYWDCYDGADEIDCQQFLLDLNCSNHSFLCISSLTHKFICLSMEK
GNDGHIDCLGGTDEPHLCRYNTQIYDNGFYCKSSQTLLPICIQRHEICYTNVTCSNMEMS
KLCKMNFEQNMFRTGVCDRGNFAILNTIDMRICYLFRFTPRHEIQHFSLVEIKSIYRDEE
RIPIPVDTLIDIFDPVREHCYRGVPLTVTLDLNKNFFYTTCLCPPNYYGTHCQYQNERVS
FTMKLQTFSDSWQIQFLLIISLIDNSYERIIHSYEQITYFPIENCQTSFDIYLIYSNRPK
NQTKHYSIHIDIYEKLSLNYRGSFLIHIPFLFLPVQRIASLLNIPYKNYPMKNCFLNECL
HGECIRYFQNDKTFCKCFSGWTGQFCTIKYQCNCSLDSICYDRSINQRSICICPIDKWGP
RCLISDEICSLNNPCQNNGTCIPYDQHVSPRNTFQCICSKEFYGQRCEYISFKIILSFSN
HINIPETMLIHFIQVKNREEPEKGIIFKKIPINRDSIIIYWPKTVHISFVELFLNQYYLI
FLEENANQTHIIKKQIQSSDYCPHIREIFNETFAQLHLIRRIKFYHFICRNYSKELSCFY
DDIYICFCIQFNNQRQVNCLEFNHTLKRDCSGRSICENGGQCLQDSSICPQTSMCICPLC
FYGSQCELTSNGHSLSLDAILGYHIQPFISLKQQPIIVQISLILVVIITLIGMINGICSF
MTFKQKELKETGCGIYLFSSSITTLFITNIFFMKFLILIISQITYVTNILFLQIQCHSID
YLIRIGLNFDQWLNVCIAVERAITVINGIHFNKKKSVKTAKYVFIILIIVIVCSNIIDPM
NRRLIMIDNNDEKRILCVLDYSSTIQKYNIIVNIFHFCLPFIINLISILIIIINGAHLKS
SLQTRQSYKTHLIEQFQQHRHLLISSFSLSILGIPRLAIMFSEGCMKTNADSWWFLCGYF
ISFFPPMLNFAIFVLPSKVYTKHFYISIAYYRKFVRRRIYPMP
Download sequence
Identical sequences GSADVT00050901001

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]