SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for GSADVT00051396001 from Adineta vaga

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  GSADVT00051396001
Domain Number 1 Region: 1239-1544
Classification Level Classification E-value
Superfamily Family A G protein-coupled receptor-like 0.00000000000714
Family Rhodopsin-like 0.016
Further Details:      
 
Domain Number 2 Region: 966-1011
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000223
Family EGF-type module 0.063
Further Details:      
 
Domain Number 3 Region: 215-254
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000425
Family LDL receptor-like module 0.0025
Further Details:      
 
Domain Number 4 Region: 448-482
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000949
Family LDL receptor-like module 0.0032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) GSADVT00051396001
Sequence length 1552
Comment pep supercontig:AMS_PRJEB1171_v1:HG381121:160374:165443:-1 gene:GSADVG00051396001 transcript:GSADVT00051396001 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKIFDRYILVILIFSSNFLYINGEYYLYDDDCLDYNVTNDAQLLTEYTVNEQQFVPFCRN
DNFEDDQDDMSDREISKLTFDQLSKRDISSLQLFEWSVHLDLVEEYQFFLENRTDKKMIS
SNFFIYNCSIKLKFGQHCQYSFNSHASFDTIVKNIFKTYIDIPSNGIGTCYIHLNCKRND
MIWCLDWREVCDGKADCWPNHVDEYFCEKLEQNDCAPNEYRCLNGQCIPDVFLLDRTAVP
DCLDSTDEEANIAQPFLSICDNNNRNPSFRCSDVSCRHWSKSISQYGRDLCELTKCRTKL
EEQINRNILLPIFNSHINENCWITMICLLKMQYLCKSICFEPRNSCTERIIKYCWPLFEF
PASSIGWSDLHFVYGWNRTKHICYNEQRCSTSQTNFRFKKISDPSIILSCESSSIDNPSD
GWLSQVRSNQRHTYRQCSLATDINDNFCSEKTQFRCGRKCISKYRVGDHHHDCSDWSDEI
PYKDTCNLSSKYRVMCEVDDPHWKGIVCLPSTNIPVTRKNDCGQNSRLPHFPTLCNGYVE
HTEYRNQRTETDEDNCEVWKCNNQYTRCNGMWNCPNGEDENNCFHEICHGSIGQPCLLLY
TSQFICLPAANISDGIVDCVGATDERQACRHISTGESSYRCLTNRICPIYETKWPPLCTD
EYYWFVQCTYFWKLDRRLTKYNLMCSLSDEVKPNPNGNYHRPEFSLDEYNVVLSTDSIDE
LLPIISKSEFTSLLNLNNQEKSLIQFQCYGGIPIYSRNQIKCLCPPYLYGSQCQYQNQRV
SITLQISAPEWRIPFIFIIYLIDEAYDIINSYYQIRYLSIQDCNTKFNFHLIYLTKPKFI
NRTYSIRIDVFEMNSLKYRASWLYPILFPILPVYRLPIHLTVPFVSLSPKRSCRRKCRTD
RGECISYTNTGEFFCRCKPNWTGSMCTIPYQCNCSPDSICVGIWKNKSICVCPTYKFGRR
CYLKNNLCKRSNAKICRNRGQCIPGNMKFPESSSTFCSCPYGFHGDLCELTDTRIDISIL
LPPIQDFLLMHFITINSHMNSNPYIPILKYGPHERATTFKKIPFDKNIVSIYWQYPFHMI
FIEYNHYLYMIFNQTNYNRTSYLKVNLQSHHQCRTIREFFNQTIMDFSLLRRVKYYHLPC
QNYSDLNCFHDEEVYICLCTLDRRANCFTFDHKIKFSCQQLSYCENGGQCFQNNLKCPSA
ALCSCPKCYLGTRCQISTRGFNLPLDVILGYRIRPGYSFSNQPISLQLSGIITLIMFIFG
LIQGSFSCITFQEKELQKFGIGIYLFTAAILSIVTISIFTLKYILFLITQILMMTNRQFL
FGQCITIDFLLKISVQIGDWLYACVAIERLLTVIKDINFNKKRSRKIAKWIILIVCLIII
INSIHEPSYRRLIYDEDERRTWCILQQTKSLDLLTSISTVFHILCPFIINIISALGILLM
RIKHRLHLDKHQRIYHHIHNQFHKHKYLIISPIGLILLVSPRIILAFQLECMKSARESIT
LFLIGYFISFLPCLSLFIIFIVPSEKYRQAFKIAIHTRWNTFYRRIRCQRES
Download sequence
Identical sequences GSADVT00051396001

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]