SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for GSADVT00052930001 from Adineta vaga

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  GSADVT00052930001
Domain Number 1 Region: 1238-1542
Classification Level Classification E-value
Superfamily Family A G protein-coupled receptor-like 0.0000000000000796
Family Rhodopsin-like 0.01
Further Details:      
 
Domain Number 2 Region: 987-1030
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000516
Family EGF-type module 0.017
Further Details:      
 
Domain Number 3 Region: 917-950
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000133
Family EGF-type module 0.025
Further Details:      
 
Domain Number 4 Region: 653-684
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000703
Family LDL receptor-like module 0.0033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) GSADVT00052930001
Sequence length 1546
Comment pep supercontig:AMS_PRJEB1171_v1:HG381149:109306:113946:-1 gene:GSADVG00052930001 transcript:GSADVT00052930001 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSFNLDVIIYLALQTVLWIYARCQFNLYDTDKIDYLQFDCLHYHKESSFSDYSIDFDSFT
QQTIEYCRRPLHESKMLSHEYTGIHVHNLTFGELREMNITTEKLVTWSVNVDVAERYQYY
LDRPKNSSIANERFLNCSKLWFGSRCQYSFEFIQTFLLYKVVQVMFQSKIAYETPHTVTN
LTCYVHIECNRGGLPMCLDWREVCNGRIDCIDGGQDEAQCFLLEVNECAKNEFRCLNGLC
IPNGISNSKDAATNCLDRSSNAILMSITSDCSEEPGFRCEEHSCSRSRNELFSCGDGECV
DVFDECRNGRHLLLMQSLSVRGNLSYNCWKAMICLSRLIDEVDGISCAQLFDSSDIHNGL
QTCEFLTQFPTIPVFFGHVRFFYYKNNTNDLNIESFRPPDLICYDERLCNFLTPTYRFEN
NTCRSAHEIGFESNFTYINLITVMNAIKPFFRGCLTTLKEVSDFHHVSLYRCKNSSKYIS
KYRIIDDISDCFMNDDEDQVELSCSLNDTRRFKCFNKTECRLSFNGRHHCSPNEKPNPSQ
LNKILFFQICDRIQDLSFETINGYNYSDETECDYWQCNNIHTRCDSLWNCPNGEDEQNCT
DTICPSYFHPCVSASNYTFTCLSADKVDDGTIDCLGASDEIHSCRIKKNDSAGFQCLNDN
KCLSSHQLCNKFTDCPLGDDEIFCRNRQYVCLIIHQSKRTVEEKVLCPFVDTEKEIYFPF
EALPTYPLSETRKVNYTTQLPVVYNLRMENINDTLDDLAWAWRCNRGLYARFRYSYDNYS
YTCFCPPSYYGDSCQYQNQRVSITLKLTAINRHNIYSIVAILFDDDDIYQEIDSHYQFTY
ITNEYCYDSHSFYLLYSTRPKNESKNYSVRIDAFTKTSLAYIESWYFKVPFLFLPVNRLV
LQLYVSTYRAINLKNCPVQCNNGMCTKYTNVNKYFCRCLPGWKGARCDISVDCTNCSSDS
ICVGSKSNRSICICPLGKYGPRCLLSRPCPRNFCKNNGQCITISESINSDNYVCICSEQF
YGDACENVKMTLKVSIYNLEIPPYLIVYALNIDSDYNPGGTIIPYKLIMHQQFLTLYIFT
DVQIVFVKMDTYYYLALLQQYPLLNTSTSISPKQRCASIFELFSYKILTLPPIQRVKHYH
SPCQTRPDLMCFFDDFYMCLCTVERQADCFKFNPNVSLACKQESYCQNGAECIQDDPTCP
SFTICVCIDCFFGDQCQFYAKGIGLTLDDILRYEIRLNTSFIHQPLSVKISAIMTMIMFS
GGLINSVLSLLTFQSKRTRQVGCGIYLFASSLMSLLTVSIFTVKFWFVIFTQTNVFINRS
ILRTGCVSIETALKLSLYVDSWFNACIAIERSVAAFKGINFDKRNSRCVAYWITLLMPII
ILSSIIHEPLHRDLYEYNEEQRILCVTSYSPIVQRYNIHIIFFHFLGPFFINLFSAVFII
FTVARLRTLTQAQQSYMKQLCKQLQEHKQLFISPIVLVILSIPRLIISLLSDCVRTSRSP
WLYLCGYFTSFIPSVLLFAVFVLPSKMYKTQLKETLKSYRRWLLRR
Download sequence
Identical sequences GSADVT00052930001

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]