SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for GSADVT00054942001 from Adineta vaga

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  GSADVT00054942001
Domain Number 1 Region: 1247-1539
Classification Level Classification E-value
Superfamily Family A G protein-coupled receptor-like 0.0000000000915
Family Rhodopsin-like 0.021
Further Details:      
 
Domain Number 2 Region: 983-1028
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000178
Family EGF-type module 0.016
Further Details:      
 
Domain Number 3 Region: 216-253
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000714
Family LDL receptor-like module 0.0013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) GSADVT00054942001
Sequence length 1553
Comment pep supercontig:AMS_PRJEB1171_v1:HG381183:59770:64482:1 gene:GSADVG00054942001 transcript:GSADVT00054942001 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MIILKVIFVLNLCISVNASYLLYDSNIPQGSYRTYDCLYAHLIESGKEFGKTYLQNYHLI
PYCRRPDDNEEEDYEIQYPIRENIAQTLSFKQLKSEQVTSEKLLQWFSPINIAENYERFL
NDSDVFHNCSSPWFGSMCQYKFPFEQNVSFEKIIEITFEKQYDIQVNISHGTCYRFLTNC
NERSWPLCLDWHDICDGKFDCLNGEDEEFCEELEMTNCNKNEYRCHYGGQCISRRFLKDG
KFSIDCLDGSDEGQDPDRFIELENINCPLQSTFRCQEHIGRYTNSFQCGDGDYMLGITLP
NSVTYCSNEKDKKVSLSLLTNMEHILNIHCQKAFYCIELFPILEDIRDEDCELLSEHCEL
EWLVIPAVPILFGFFQFVYFTNRSINDFKISIEPDLICFHERACPSLLMDILPIQYINGL
TCFSPVNLSLIYELSDFNDAFTAFSHYNTYCRTKGTDLSCTNSLDFFCNQSMKCISYNRV
GDGNVDCYYREDEQFNACHLNDSNRFQCLSDSTKCLLQVAIGNQMIDCHDDEDELFAYTQ
DLFVLIPYPYICNRDSNFFTYFNSMNYTDESNCHWWPCNNPYTRCNKLLDCSNGIDELNC
PNSKCSFNEYECYNEQLELFYCISLIDMYDKYSNSCNEIPVERNVYFYNGTNDISRDYFS
WNNSQCVNLEILCRLNSSFEENICLYSLIDNFYWITDYNVKLIPNDENLCRFRFDYNSNT
LPYFKTTQLGYFPSLSTNHSNSILSQTNPTKRFTVSDMNVESVFYCHRGILVLNGLNQTK
VCFCPPNYFESQCQWQNQRISLTIQLVWHSVTFQMIIFELIIMLINEQGQIEPYHERITY
MPDRDCNTKYNLYLLYPDRPKSLSKNYSIRIDIYEKTNLIYWLSWYLPIPFQFLPVNRIA
TQIPIPEQPNHESCTLSCGEHGKCMNYINNKSLSFCLCNDGYSGTYCNVKHQCYCADNSF
CLTSSICICPLNKFGLYCHLKHSICQVKTNNSCEHNGICIPRDDRIDLNEFTCFCPEDYS
GKRCEIRNSRVDIQLNEEIRSITSLLIIHLITAFHYAEHERRTLLKKLSPNQKILTIYMT
KPFHLVFVQIPNQFYYLTILREVYQSSEYIRTEIQIKKRCFSSNQLLNETQQHYDYLRQV
KYYPLLCRKNLELECFYDQEHMCICDQDRFANCFVFNHTITNDCSDYNYCENQGQCFQNN
ATCPTKLTCICRDCYYGGKCQFSTKGFIFSLDTILAYHIKPKVSLSQQSFIIKISIFIST
ILFLIGLINGLLAFVTFRRIKVRRMGSGYYLLSSSIVSIFTIITLTYKFWFLIISQTSFI
TNRSLLHLNCILIDVLLRILLASSEWLNCCVSIERMFSVIMGTHFQRKKSIRFSKRIIVI
IFILVTSTHMHEALYRQLIDDFDIDEHRIWCFVRYSSLIQKYNSFITLFHFLTPFSINII
SSYWMITQLAYRRHDVERGQTLKDHLKHQIQQHQHLLYSPLILILLSLPRLIISFTHTCM
RSTQEPWLFLIGYFLSFVSSMSIFIVFVLPSNMYKAEFNAVVEQILKKFRTTQ
Download sequence
Identical sequences GSADVT00054942001

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]