SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for GSADVT00054986001 from Adineta vaga

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  GSADVT00054986001
Domain Number 1 Region: 1240-1543
Classification Level Classification E-value
Superfamily Family A G protein-coupled receptor-like 0.0000000000000915
Family Rhodopsin-like 0.011
Further Details:      
 
Domain Number 2 Region: 211-246
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000119
Family LDL receptor-like module 0.0018
Further Details:      
 
Domain Number 3 Region: 966-1012
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000698
Family EGF-type module 0.03
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) GSADVT00054986001
Sequence length 1549
Comment pep supercontig:AMS_PRJEB1171_v1:HG381184:97890:103246:-1 gene:GSADVG00054986001 transcript:GSADVT00054986001 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MIFIIWLNFFYLNGKYYYLYDNDCLDYNATDYEPEPELVTSEHQIISFCRVDNFEYEQYN
EIDKDISQLTFYELYIQNITSLQLYQWSVHLDLVEEYQAFLENRLDINILTANLTIYNCW
IKQKFGRYCQYSFDSQSRFFHLVKTIIFYRFYRNHLLLYVSLSCNGTCYMHLNCKRNNVT
WCLDWRDVCDGKVDCWPNHVDEQFCESLEQNQCDLNEYRCMDGQCIPEIFYLDGSFVPDC
LDGSDEGIREKYKYACRKGDNPSFKCHDVKCRHWIQSMSSTSCRPLAEIERNSIITRQMD
EDLLLPDVNTHINKECWTTMICLNNPTYAHLFTGSCRNICFEPDIPCTKRLMEYCPSLFE
FPALSVGWSDLHFIYGWNRTNTSLGYPNYVCYNERRCSISQLNIYFKKKSESSTILSCEF
LHLDYINIEWITKLQFYRKHMHQQCSLATDINENYCSEHTQFRCAKKCISKHRIGDFFQD
CINFMDENLYNDTCSLNLKHRLACTSDIAGTKQVKCLRVINTLPQAGMICTDDLEIPHFP
TLCNGLSEFEENNETNCEMWQCNNQYTRCDGIWNCPNGEDENNCFHEICNGLLGQPCLLL
YTAKYICLPIANISDGIVDCIGATDEQQACRNIGERVSKYRCLTNRTDNKQFANDIFSTC
SRVLSSFLFTDGGICTLFQHNIMCSLDENLFFHTYWKSKRPQFSVNNYNIISAIGESLVD
NSKASIVTNRKKSTTLIHFTKQGIVLNNFQCHGGIPIYSGKHITCLCPSFLYGLQCQYQN
QRISMTSEIGAPEWRIPFVFIIYLIDETLEIVNSYYQIRYLSIRDCNRKFHFHLLYSTKP
KYFDRKYSIRIDVFEMNTLVYRASWLYSILFPVLPVYRLSLHLTVPFVSLSSCPLKCPVD
RSQCSLYRNIGKFFCRCKSGWTGSMCTIPYECNCSPDSICVGTWMNKSICVCPTYKFGRR
CYLKNNLCERSNAKKCRNRGQCIPGIVQFPRSFPTICSCLYGFHGELCEFKDSQIDISIH
MSNIPDSLLIHFIIVNSHMNSLPYEPILKYGPHERATTFKRITFDKNSVRIYWQNPFHLI
FVQYNSEIFWIFSQLKYNRPLHLKLTLQSHFRCPSIQENLLNQTILNYPRNQRVKYYHIP
CQTNFNLTCFHDQDQYICLCTFDHRANCFTFDHQIKYSCQQLSYCENGGQCFQNNLKCPS
SAVCSCPKCYLGTRCQLSTRGFNLPLDVILGYRIRSGQSFSQQPISVQFSGIITMFMFLF
GIINGILSILTFQVKELQKIGSVIYLFIASIISIIIILIFTLKYLLFVLTQILMISNRQF
LFSQCITIDFLLKITVQIGDWLYACVAIERLITVIKDINFNKKHSKIIAKWIILFVCLIV
IISSIHESFYRRFIDDEDQERIWCILDQSNALNLFTSITTVFHIICPFIINIISALGIVL
MRIKSRLNLRKDQNIYEHIQNEFHKNKYLIISPIGLIILVLPRIILAFQLECMKSARESV
TFYLIGYFISFLPSLSLFIIFILPSRKYRQVFKKSMQIRWKKFSQWIPC
Download sequence
Identical sequences GSADVT00054986001

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]