SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for GSADVT00055123001 from Adineta vaga

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  GSADVT00055123001
Domain Number 1 Region: 941-1255
Classification Level Classification E-value
Superfamily Family A G protein-coupled receptor-like 0.00000000000595
Family Rhodopsin-like 0.02
Further Details:      
 
Domain Number 2 Region: 692-730
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000726
Family EGF-type module 0.024
Further Details:      
 
Domain Number 3 Region: 261-296
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000877
Family LDL receptor-like module 0.0035
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) GSADVT00055123001
Sequence length 1260
Comment pep supercontig:AMS_PRJEB1171_v1:HG381188:6722:10609:-1 gene:GSADVG00055123001 transcript:GSADVT00055123001 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSSECRYNLECFLRIPVVEFSENDCRYLPRFRFLELIKKYCPEFIKVPLILFGHVQLIYI
NNQTQEKFHLYSHRLIVPDYICYIDNPCIQQLFAFPLFSSIHLFNDNSTCRSFDDFGFTD
NILQGWTHFINEIIRLFRKCTSFFELSPSFDNLNVYECVNSLEIISKYRLLDGIEDCLYG
DDESYSDSCSLENFNHRFKCDQDINMKCISQSLIFNKEHDCQDQSDERENLQKDPQTSIV
FQMICDGYIQIDPILIDNHNETDETQCHHFPCNNIYTRCDGYWNCPDGVDEVNCEWPSIC
PSFHHICLSPISGNITCLHLKHVNDGIDDCLGASDEREFCRRTYKFTPGIRYRCIYTNMC
ISNYISCLQPLNCPKNNQSSITFCQNLHGVLYWKCFFKENLTHTEQLLCTLNDLREGFNA
HFTLIGSTSYSFPQTNPFLAVRAISQNNIVSNQRINSKISIDNSFLTRYCNRGIMIHRFI
QRENKTNMFCFCPPAYYGSLCQYQNQRVSLTLKIRASFEFRTIFAIIFTLRKTVDKQIES
FDQIDYYYERDCQTKFNIYLLYSTHPKNSSTNYYVQIDIFNEHDFNYQASWFFPILFSFL
PVYRLAVQLQIPPANSMTRKCTTLNCGLHGQCFSYINSKTSFCLCDEEWSGQYCQISYKR
SCSLNSLSYDRKICICPLEVFGPRCYLKYSKCSCENGGTCILNNKRLYQNDDYLCVCPKG
FSGLRCEKHDTRISLSFAPEIQIPSSIFLHFIEVFSKNQSHLRSSIFKIIEIDQERVSFL
ISTRFHLVFIEINRPKTYYLIVIQQEYRPSMNITSIIQSSNRCLSITEIFNETFSNWHLL
RRLKYYHIPCQKHSDLFCFYDDIHLCICDKNLHQANCLTFNHSKTHDCEEENPCENQGEC
FRDDPNCPRTFMCICNQCSYGSRCQFSTKGIGLSLDVILGYYIIPNQSFENQRSLIFIIT
TIVLLIFFIGLFNGILSLMTFQTKKSCEVGCGNYLLICSYSSIIIFILFALKYFLLLFTQ
MNLITNRSYLTFNCIFIEYILKVSMSVADWLISFVGIERLITVLKDAKFNKIQAKKLSKL
IIICIYIITALSYIHDPIYRRMIDDKDEEEHYRIWCHVQFNSSFQWFNSIVLALHFFIPF
ILNILTAILIIVITARQRTIAQKQQSYKIQLRKQFHQLKHLLIAPIVLTILASPRLVISF
LSGCMKTTRGYLWLYLTGYFISFLPSTFLFIVFVLPSQAYKNEFHQTIQHLQRRMPTYLT
Download sequence
Identical sequences GSADVT00055123001

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]