SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for GSADVT00055165001 from Adineta vaga

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  GSADVT00055165001
Domain Number 1 Region: 2494-2756
Classification Level Classification E-value
Superfamily YWTD domain 8.63e-46
Family YWTD domain 0.0000149
Further Details:      
 
Domain Number 2 Region: 1545-1777
Classification Level Classification E-value
Superfamily YWTD domain 2.22e-41
Family YWTD domain 0.0000205
Further Details:      
 
Domain Number 3 Region: 3361-3621
Classification Level Classification E-value
Superfamily YWTD domain 6.41e-41
Family YWTD domain 0.0000441
Further Details:      
 
Domain Number 4 Region: 390-622
Classification Level Classification E-value
Superfamily YWTD domain 1.57e-32
Family YWTD domain 0.00014
Further Details:      
 
Domain Number 5 Region: 4188-4443
Classification Level Classification E-value
Superfamily YWTD domain 2.49e-28
Family YWTD domain 0.00014
Further Details:      
 
Domain Number 6 Region: 688-912
Classification Level Classification E-value
Superfamily YWTD domain 4.84e-27
Family YWTD domain 0.00049
Further Details:      
 
Domain Number 7 Region: 2175-2414
Classification Level Classification E-value
Superfamily YWTD domain 5.49e-24
Family YWTD domain 0.00043
Further Details:      
 
Domain Number 8 Region: 1887-2086
Classification Level Classification E-value
Superfamily YWTD domain 0.0000000000000101
Family YWTD domain 0.0012
Further Details:      
 
Domain Number 9 Region: 1493-1540
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000000363
Family EGF-type module 0.0065
Further Details:      
 
Domain Number 10 Region: 3312-3363
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000000648
Family EGF-type module 0.01
Further Details:      
 
Domain Number 11 Region: 216-256
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000000733
Family LDL receptor-like module 0.00083
Further Details:      
 
Domain Number 12 Region: 2968-3007
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000000759
Family LDL receptor-like module 0.0011
Further Details:      
 
Domain Number 13 Region: 3705-3747
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000183
Family LDL receptor-like module 0.0014
Further Details:      
 
Domain Number 14 Region: 1204-1240
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000183
Family LDL receptor-like module 0.00087
Further Details:      
 
Domain Number 15 Region: 1081-1117
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000183
Family LDL receptor-like module 0.00087
Further Details:      
 
Domain Number 16 Region: 3183-3221
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000314
Family LDL receptor-like module 0.0017
Further Details:      
 
Domain Number 17 Region: 3748-3783
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000109
Family LDL receptor-like module 0.0014
Further Details:      
 
Domain Number 18 Region: 1002-1038
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000122
Family LDL receptor-like module 0.0009
Further Details:      
 
Domain Number 19 Region: 3145-3184
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000183
Family LDL receptor-like module 0.001
Further Details:      
 
Domain Number 20 Region: 2839-2882
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000223
Family LDL receptor-like module 0.0014
Further Details:      
 
Domain Number 21 Region: 3946-3987
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000038
Family LDL receptor-like module 0.0016
Further Details:      
 
Domain Number 22 Region: 21-60
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000406
Family LDL receptor-like module 0.0013
Further Details:      
 
Domain Number 23 Region: 1042-1079
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000419
Family LDL receptor-like module 0.0014
Further Details:      
 
Domain Number 24 Region: 1165-1202
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000497
Family LDL receptor-like module 0.0014
Further Details:      
 
Domain Number 25 Region: 96-133
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000524
Family LDL receptor-like module 0.0014
Further Details:      
 
Domain Number 26 Region: 3995-4029
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000602
Family LDL receptor-like module 0.00094
Further Details:      
 
Domain Number 27 Region: 3105-3138
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000694
Family LDL receptor-like module 0.0011
Further Details:      
 
Domain Number 28 Region: 181-218
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000707
Family LDL receptor-like module 0.0014
Further Details:      
 
Domain Number 29 Region: 3015-3050
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000128
Family LDL receptor-like module 0.0024
Further Details:      
 
Domain Number 30 Region: 3782-3823
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000196
Family LDL receptor-like module 0.0013
Further Details:      
 
Domain Number 31 Region: 1244-1283
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000223
Family LDL receptor-like module 0.0011
Further Details:      
 
Domain Number 32 Region: 1367-1404
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000288
Family LDL receptor-like module 0.001
Further Details:      
 
Domain Number 33 Region: 1326-1362
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000034
Family LDL receptor-like module 0.0012
Further Details:      
 
Domain Number 34 Region: 4037-4071
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000367
Family LDL receptor-like module 0.0024
Further Details:      
 
Domain Number 35 Region: 2806-2843
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000038
Family LDL receptor-like module 0.0014
Further Details:      
 
Domain Number 36 Region: 1278-1322
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000458
Family LDL receptor-like module 0.002
Further Details:      
 
Domain Number 37 Region: 3906-3945
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000458
Family LDL receptor-like module 0.00074
Further Details:      
 
Domain Number 38 Region: 3867-3907
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000537
Family LDL receptor-like module 0.0013
Further Details:      
 
Domain Number 39 Region: 3822-3864
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000013
Family LDL receptor-like module 0.0016
Further Details:      
 
Domain Number 40 Region: 3235-3266
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000274
Family EGF-type module 0.01
Further Details:      
 
Domain Number 41 Region: 259-294
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000471
Family LDL receptor-like module 0.0025
Further Details:      
 
Domain Number 42 Region: 2884-2927
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000602
Family LDL receptor-like module 0.0015
Further Details:      
 
Domain Number 43 Region: 3666-3703
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000641
Family LDL receptor-like module 0.0022
Further Details:      
 
Domain Number 44 Region: 58-97
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000772
Family LDL receptor-like module 0.00091
Further Details:      
 
Domain Number 45 Region: 2931-2970
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000105
Family LDL receptor-like module 0.0012
Further Details:      
 
Domain Number 46 Region: 1456-1506
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000138
Family EGF-type module 0.01
Further Details:      
 
Domain Number 47 Region: 141-178
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000275
Family LDL receptor-like module 0.0026
Further Details:      
 
Domain Number 48 Region: 3052-3101
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000034
Family LDL receptor-like module 0.0026
Further Details:      
 
Domain Number 49 Region: 4085-4118
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000055
Family LDL receptor-like module 0.0026
Further Details:      
 
Domain Number 50 Region: 1805-1850,2129-2168,2749-2808
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000124
Family Growth factor receptor domain 0.0087
Further Details:      
 
Domain Number 51 Region: 632-685
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000136
Family EGF-type module 0.0087
Further Details:      
 
Domain Number 52 Region: 1409-1449
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000183
Family LDL receptor-like module 0.0025
Further Details:      
 
Domain Number 53 Region: 4119-4153
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000274
Family EGF-type module 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) GSADVT00055165001
Sequence length 4703
Comment pep supercontig:AMS_PRJEB1171_v1:HG381189:12773:34465:-1 gene:GSADVG00055165001 transcript:GSADVT00055165001 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MNLKLLIFLFCSNFLLLYSTTDACGINEWRCETGGRCIPVAWRCNRINDCTDASDERNCT
YSRCMDTQFDCGDRCIPLSWRCDGDNDCANNTDEQNCPPRRCSSTQFQCNDSRCIEASMK
CNHVKDCTDGSDEGAFCNYRQCDPSTEFQCDMQRCIPLTQKCNGYYNCDDRTDEFNCNGT
VCSTSQFRCVADGRCIPGYQRCDFRLQCIDGSDEANCTRPNCTQAQFRCANGRCIPSSWV
CDRDDDCLDRSDEMHCGARQCPPHMYPCNVTGQCIDITKVCNGQQDCTDGTDENAQCGSR
FCGLYSCEHACRPTPDGRGICYCPVGFQINPVNNRSCIDVNECEIWDECDQDCRNTVGSY
ACSCRANYTLETGNRCKHINSDNMKMFVAIANKIYEIDRLGNARIMYTGRENMTINAVDY
HYRNRILYFTDSRAHQIYSLSLSSSSSSGATLILEKNILTPVSIAVDWITNKLYIVEFEL
ARIDMFSLDGKQMKTNIITSGIHRPVAIAIDPIAEYLFFADEGDSHRVPAKIFRCLLDGS
QCTVLIDQKLDQPSDLTVDHIKQRIYWVDRSFDHVESCDYHGARRITITSGSQNIPFTVG
IDLFENNLYLTDDMKGAVLQLRRHFSSNTNRINPCNGTYNGGCEHLCLLGRANLLANSYQ
CRCQSGFRLKSDLKTCEPVKDFLLLTRLFSIRGIDLNRDSKIEARSPIVPDPRTVIMDSV
FDYRQKLVYFYSERSQMIYVSYMDGEKPKPVTTSKIFPLVSAMTYDWFSKLLYMTSSTER
QILVVRMNTTDFPQRVLVNDTIGLYGITLDPSQGYVFYSTIARPAKIYRMLSDGTNRNVI
VANELGTPYHLTCDYMTKRLYWTDGTLSRIQYSDYNGRNIQSLKGRSISHPFGIAISGSR
LYFTDMTLESVFESSKTYSGYASAIRSNIPAISTVRVYAESSQPMNITHPCWTNNGECSD
FCFPKREQGTLTRICGCRYGRKVNSMNNILCVDNSEAEPSQISCNGRFQCRNGRCIPLSY
RCDGDDDCHDNTDEQNCPAGTPQCRTTQFQCRSTGVCINKQLVCDGYAHCLDRSDESNCS
QTCADNQFRCATGRCISKSWLCDNENDCGDSSDEQNCHERTCDPLTQFTCPHTPGKCIPT
GMLTEKFFSTLFFHFIECINIAGTPQCRTTQFQCRSTGVCINKQLVCDGYAHCLDRSDES
NCSQTCADNQFRCATGRCISKSWLCDNENDCGDSSDEQNCHERTCDPLTQFTCPHTPGKC
IPTAWRCDGQNDCGDNADELDCPPISCGTGQFLCTRDQRCINATRRCDGISDCPSMEDEQ
NCAGSTPTFCRADQFRCGTTCIPNAWRCDGHRDCADGSDEPSTCGARNCTSTEFRCLSSS
ECIPETWVCDHEDDCEDGSDEHTEQCQAAPFSCPDNQIPCPDTTIHQCVNVSQVCDGKPD
CPGGGDESPLCNNDQCSVNNGECSHICHASPFGVLCLCELGYHVTNSTNYKKCEDIDECV
EDPFTCHQYCLNTNGSFVCGCGEGFILQPDGRSCKIINESGIRLLAAYGSSIGWFSPTLE
TFGQVTLGSDIRYISAFDVDNRTDTYFWSDLASNTIYSRSSRANNYTKIISSGNSYIASI
AFDWIGRNLYWTDYILEHIEVASADGRHRRILLHENLTNPWAIAVDPRPGVRFIFFTDWG
KNPRIERCSMDGQQRMTIVNDSIQMPFGLTLDFIREKVYFSDRHLNYIEVVSYTGENRRK
ILANTHFLHAPTSIAIFENYLYWFDSNSNEVRRLNRFEHGIKAQKHTRILSRSGINHLKI
SHQIYQPSGANPCQQARCTQLCLLSHTASSGYTCACSTGFYLERDQFTCTKDYSPFIIYM
RSRTIGGINVRHDQRYVDENSNYDDLWERLVTVTDIDHGYEFAFDEANETIYWTQTKGIL
PDGSLTYEIRRINFDGTNETVFYGDDEILVGMEIGTMQVDAVGRNMFIVNFYHSRIDAIS
LNGQYHTVIYSSQENETGIMRPIALDLDTTNGYVYWIDLGGGQVPIKIGRVRFDGKHSEN
VITENLLQPNYLVYNLDLHCIFWSDTGIQKISYHCMDSGDTKVLDVEGVYKKWFDHNLNP
ITDIIPVRVNQRDPIQVRAYPRYEALNSYCYYGSYCEQLCFQIDSINHNTPTCDCAIGYK
LNSDGRSCSPKSQQYIIYSTHSLLRAFDHRSNDSTREDVMPLIAGNNMEMLSVRYSTREI
YWIHANRLIRRAIWTDNRTWNVTTHLQISVAAEQNYVLGLALDWIAGNLYFSYVSNKYGH
LEVNRLGTDHRLILRKGTNETIYALAVNPKRRYLYWCDRGARAHITRSFLNGENVTYLVT
TQIIRPESITIDYLTDDVYWSDIIRDTVEVISWDGKNRRTVSRNIPKAISLLIANNDLYI
MDRAFSSILRINKTASNMTQRLESVLSLKSYEVGGMALFDEQPNYESPCQSSTVRQRFCE
DLCFSMPGTSVPQCACAFGTLSVDQRTCQPPKEYLLVAMEKEIRSMSMQPHGLATSAPWR
TIRNLSMAVGIDFDYRDKKIFYTDIQVQDIFSFDMDDPNPNARRLVQSNVTGRSQPVGIA
YDWVSDRLYWTDETYGRIISARNNGSEKVIIAASSRPRAIAVHPCKGLLFWSDVGPSPSI
RRSTLTGRQVTYLITTNIRWPNGLTIDFDDDRIYWADAWFDRIERASLDGTNREVISSVV
HPFAITVHGHYIYWTDWTLRGIYRAEKYTGANMVEMQNNLPYRPMDIHVVSDQRQKCSFS
PCNISNGGCSHICKTGLNNQVECTCPSGQQLKLANDRRMCVPLSSSCASVNFTCRNGQCI
SRRKVCDGQGDCSDNSDEDTRFCSAYTCRPTEYRCLSGGCIPYIERCDRKIDCNDGSDEN
NPYQPCVYPQCPEGQFTCANFRCIDTFKRCNGFDDCNDGNVTDEIGCPSRICNGTNSMKC
PNNNICIQRSYLCDGDNDCGDNSDESPIFCQSIQCNTTEFRCGNGRCIPYSWVCDSRRDC
ADGTDEPADCRSSNRTCPIELWKCDNGRCISPDQRCNGIDDCRDGSDEDERHNCAEMSCR
STQFRCPTGLKNNPRIRCLDQSAVCNGIANCMRAEDEANCTRRNCSSASQFQCDNGLCVP
RSYVCDHDNDCGDGSDEPASCASQYRNCTSTEYRCENGRCISKSLTCNGFNDCHDNSDEK
PSLCQTEQCPGGQFQCRNKQCIPYEVVCNGVRNCTDGSDEPASCGVNECASTILSGCEHG
CINTLTSFRCTCRPGYKLATNKKNCWVRLQLIKSQIYVMCRFNTYLKSISDIYFFRILLH
IFRRNILLICSYLDINECVETPSVCQQLCENTQGSYICKCASGYEKGLDGRSCYRTNRTI
IPHVLYTNKYYIRAIDLDEQTEMTIARGFLDLSSITYDWKDRKLYVGDNMANKIYRMNFN
GTQSTTVIEGNQVRYLRALAVDWIGRKLYQLSSMPELRVCELDGRNQITLLNSRYLSQPN
YLAIDPLVGYLFYSDWGQPHIGRINLDGSNFVKIIGTDTAGPLGLTIDIITKRIFWIDRR
LQRLEFSNYNGGERKIAFSGHDYVPYSLGLGFIDGYVVWSDFTNHSLIRADALNGSNKHV
LLPDTINEVVAISIIHPSLQPQIPNPCGTNNGGCSHLCLLSTNQSYTCACPEYFSFLNNG
NNRTCVTNCSCNQHRCGSPNERCIPWSAKCNGVIDCEDGSDEPSTCPQRQCAANQFQCRN
QNCTPISFVCDGMDDCRDNSDEENCECRCMPGTFRCNSGACLPMRFRCDGARHCSDGSDE
LNCGNRTCSHHQFTCANGHCITASYECDLDNDCGDNSDENAYFCRNRPCRPDQVRCPNSY
KCISNLARCNGRDDCGDNSDENPNQCPLCNDASHFRCNDGGCIPRSWRCNHRNECRDGSD
EDPETCIYRECSEDEFRCSNGRCIPQRWVCDHDYDCGTGDTSDETTDCVARPCPDGRFKC
ASGHCVSNTSRCDGIPQCADVSDEAGCAPRYPNGTYCPADRFTCNNTLCINKNWACDGDN
DCIDNSDETLEVCRTVPCNTTNHFRCTNGRCIYRWRVCDHVDNCGDGSDEDIHGICRTRN
QPLTCPQFRCPHTNRCIRFSDLCDEFDDCGDESDELTYINECQNSTLNYCSQICINKKGG
FHCECAAGFEPSGVNRSDCHAGDPTIDLLISEPEDIRRLRRNSADNAAHYGVLIEDQHNA
GFISIDTTNRMFYWIDESNYEVYRAHLTPSSISIAHPQELLFEDTDHTINPTSISIDWIG
QNLYATDTTHGCIWVMKNDGRYATKLITNIESPWVVAVNPILGILYFINYEYEMYNNVTE
RVVAIESAYMNGENRTILVDTDIIYPTDLVIDFYQNYRVYWTDEKKESVESMNYDGTDRI
TIAHIGIHAPHSLDIFGSHLYWINRENRSLNSIEKFGRGVSTRVLDHLESPLFVRIYHPL
KQIQSVSNPCSTSNCSHLCVLKPSNQYQCLCPLDTDMQVDSRTCNAPIVAERENVLQCNC
VHGKCVYQADENTNYRIVGCDCLPGFTGERCDRRRFIDTVFKHKYKFIIGVLITFLLTGI
VVFALIQVKRRGSIQSVPTLPLPTALRSTWNNLRNFVTRSTDTINTVRFRNARSTTASNA
STLTSPPVFSNPMFGATTTSSQPSGSGSLSDEPAKLNVELQPPPSKPNRKAPPPKQQLQQ
FDPQSKETDHDKASLVERNKNKT
Download sequence
Identical sequences GSADVT00055165001

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]