SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for GSADVT00055317001 from Adineta vaga

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  GSADVT00055317001
Domain Number 1 Region: 40-74
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000144
Family LDL receptor-like module 0.0036
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) GSADVT00055317001
Sequence length 517
Comment pep supercontig:AMS_PRJEB1171_v1:HG381192:99747:101518:-1 gene:GSADVG00055317001 transcript:GSADVT00055317001 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTNTLQGERGECKIEEKIPHFPTLCNGHIQHTEVSNGEVKTDETNCEAWQCNNQYKRCDG
VWNCPDGADEAECLHTICQGLVGYPCLLRHTAKYICLPTSNVSEGIVDCLGATYEQQACE
NNHSHEEKTSVLCVRSFFLFNRTKMCIAIEQVYDEEDGCPIRDPNCFYWMYDRRLTARNL
ICSLDRPMKPSTWLQFKMQQFSLSKYNVIFPYARNWQLPSVISKSASSIDVVQRIPLVIN
STSQRTSLIAFQCNGGIPIYSDNDIKCLCPPFLYGAYCENQNQRISVTLQTGAPEWRVPF
VFVIYLFDETYGISNSYNKLRYVSTRDYNTKFNFHLLYSSQPKLSNRIYSVRIDLFEMTT
FKYRGSWLFPILFPFLPVYRLPVYVTVPFVSISSTIDCPLKCHPGHGQCVSFLNANKYFC
KCQTGWTGLKCETSYKCNCSSDSICFGISNNKSICVCPVHKFGRRCYLNNTRCEQPDAKK
CQNVGQCIPGDMPIHSGSTTTCVCPQSFHGDTCMLME
Download sequence
Identical sequences GSADVT00055317001

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]