SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for GSADVT00055378001 from Adineta vaga

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  GSADVT00055378001
Domain Number 1 Region: 953-996
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000188
Family EGF-type module 0.011
Further Details:      
 
Domain Number 2 Region: 648-685
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000471
Family LDL receptor-like module 0.0023
Further Details:      
 
Domain Number 3 Region: 160-197
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000367
Family LDL receptor-like module 0.003
Further Details:      
 
Domain Number 4 Region: 449-479
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000432
Family LDL receptor-like module 0.0032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) GSADVT00055378001
Sequence length 1229
Comment pep supercontig:AMS_PRJEB1171_v1:HG381193:138059:141748:-1 gene:GSADVG00055378001 transcript:GSADVT00055378001 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKYLIVTLFFYSAIASPQINLYHTNDDYQQHHCLYIDLSENQWSHDIIPYCMSELTSKWS
IEQANYHSHLTFTELKHRNITSTQLHQWSASIDTSERYQLYLNNDHHFSVSGENIFYNCT
LPSFGPQCQYQLENYDSTLTLNEFVRRYYLQHTKASESLTCYTHLRCNRGLTSVCLDWSE
ICDGKFDCDDRSDEEHCSSLLNNECGADEFRCNNGQCVPSKFVNVGDSFECLDQSDQYGT
FSKNSMLNEYRAPTIRNEDIVCSWHNYSKTQFLRPLTSSCQFSRHQRIQQAMLDEQANAM
ISHRCFSALQCHLKISTYNESLCSNICKNQPCIEIIAMMCPSMFFYPSVPIAYGHIYFAY
TIEYMTNSTNMEKMLPEYICYDQQQCGEFKSDATVLNERMTCSRPNDFPISDHFFEKDWF
SSYIGRIHLELAHCNPATYNKSGCDSSIMYQCKNSSRCISKSYIGDGIRDCDYGDDEEQR
TINNECLIDKNGIFFKCRTENKCIHRNRVEDGNCDCSRDEDNMCDDENLKSNQNRLEIKF
STICDRSLDLLPILIDGSSHTDETDCAQWPCNNTYTRCDGFWSCLDGADEVDCHPSPPIS
CPIHHHICISSRTYQPQCLPIHRAHDGNIDCVGGIDEPTLCPVGNRHREPRQFYCKNGNT
SLCLPWYAVCDGQINCENGDDELFCNSSMIDILQIDPHVRYRNDVQPHTKEINRELAIMD
NYCHRGLLVRVTLDNRRNLTTRTCLCPPAYYGDRCQYQNQRVTLTMELTSSIESRRTLYV
LFVLLIDDSNEQIIHSHEQISYLPMRDEFVKYNLYLLYADRPKDTRKQYSIQVHIYEKQT
LHYRGSMLLPLKTPFLPVERIAVKIDIPSAKDIIPTCTNNRCMHGRCIQYLHDSKANSFC
QCDSGWTGRYCNISYNCMCSLDSLCIGIDANNRSICACPLNKFGSQCLLPNTICQTNPCL
NGGVCIPSDEHSTSHPPYLCTCVRGHHGRRCEMPDHNVTISFPNEFNISSQSSIMFHFIN
FINRNLHIHHKSPARVCDKKTSITNYWSHPFNAVFVQLLSTVQYYLVSTEKVDFPSTIVR
QLHPSDRCRSIMEIFPERITKMHRIRRIKHYHEPCWNRSADLSCFYDENDMCLCQNDGTQ
RIANCFEFKHRMKLDDLNLAYNQIENDCRVDPPSSVSTSSISTISSKSSTSTIRSSTTVK
NNGISSIYKCKNFLLIFILMFYFLVHHKP
Download sequence
Identical sequences GSADVT00055378001

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]