SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for GSADVT00055540001 from Adineta vaga

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  GSADVT00055540001
Domain Number 1 Region: 539-734
Classification Level Classification E-value
Superfamily Sec7 domain 8.37e-71
Family Sec7 domain 0.00000196
Further Details:      
 
Domain Number 2 Region: 1039-1369
Classification Level Classification E-value
Superfamily ARM repeat 0.00000000000709
Family BC3264-like 0.08
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) GSADVT00055540001
Sequence length 1704
Comment pep supercontig:AMS_PRJEB1171_v1:HG381197:76715:83935:-1 gene:GSADVG00055540001 transcript:GSADVT00055540001 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MFLRRALETLLNDKDIKKSQYQQLKRACETALASVTKDTQTTNAPSINETYFLPFELACA
SNHPRMIDTALDCLQKLLVNGHLIGSAPDPTDPSKFLIDRIVTLICACFRGSQTEEKVEL
QIIKICLTIMTSQTIEIHQRSVLQIVKTCFNIYLTSRSRINEATAQGSLSQILMGIFNKM
EQKMSTTDYDQEQSVIKEILDELVEKICYEHTNNSLSTNDIIEDIPSTQGEIIDNISQNS
QSIDDQSSGRFGMSNSLSADELSADNYFKNAFYVFRALCKLSDRDIKDKGNPDPRINLDL
KSRIFSLRLIMQILQTSGPFFRSSDDFLQLIKTNLCVSLSRNGVSSILELFEMALFNFVE
LLDKFKSHLKIQIEVLFREIFLTILETSTSSFRHKWLVIQTLAKVSADAQIIVDLFINYD
CSMRSANIFERLVIVLSRAAQDYLSFISVIGCNQTEEHNLRIKGLECLVLILKCMVEWSK
DLYVNPHLQSNLGPDSKPLNENGYDQDSNRSSSGYVGSGMRRTDSNGSINSSQSSELIND
FEVIRQRKELFEKGIDLFNQSAKKGLEYLCEKNLLNNEPEEIAQFFHAYQDLLDKTIIGD
CFGEDDKHHKQIMYAYIDQLDFTNMEFLAALRKFLAGFRLPGEAQKIDRLMEKFAGRFCE
CNTNLEIFASADAAYVLAYSVIMLTTDLHSVNVKKKMTKEQYIKMNRGINDSRDLPEEFL
SKIYDEIKNEEIKLKVTTMKRGTKENITNDKQRELLFNVQMKDVETIARDLMSNAGSSSE
EFTIAKHLEHVRPMFQKAWSPCLAAFSVNLQDSNHIDLANLCLTGISYAIRIACIFHMEL
ERNAFIQTLSRFTLLMTTSQVMEIKAKNVECLKTLISVAQTDGNYLGEAWYDILKCISQL
ELAQLFGVNDNKTKSSVANSYHHSHIPTHQGSTTFSLPFDNLFNTEKSQLKRIQSMQDQI
HVTTTQNVVVAVDRIFSGSARLDGDAIVAFVQSLCHVSMDELYSTPPRMFSLLKVVEISY
YNMGRIRLQWSRIWEIVGDHFNKAACHPVQDVSFFAVDSLRQLSMKFLEKGEFPNFRFQK
EFLKPFEIIMKKNSSTTIRDMVVRCITHFVDAQAKNIRSGWKNIFSVFQMAASDTDVQIV
ELAFQTCTLIVGVVFDRYFASVLDSFQDAVKCLSEFACNISFPDTSMEAIRLIRQCAKYV
AEKPQIFREHAGEDLINVSEEDRIWVKGWFPILFELSCIISRCKLDVRTRALTVMFEIMK
TYGETFTQHWWIELFNVVFRIFDNMKLPDTQIEKIEWMTTTCNHALYAIVDVCSQFYDDI
PESLVNDLYCQLKWCVNQDNEQLAKSGTNCLENFVIACGQRFTLTIWQKTCTCILEVFRS
TLPEMLLTWRPDTDSSTMATINEITMLDRTDSSFDYAAVESASSQHNRMTRVNSVSSAQS
DQPEINFNTRLSSNSITDRTKPTSDFTLFQILTIKSLVQIELIQTIDNIIFYPSTSKKED
LQYNSVARALANTQLGQENSSYFSQSDEIHNEHGMYEYMSFDQLILLVDCLIESHMFARA
FNANNEQRNFLWKAGYRGKAKPNLLVQETNSIACAFRILFRLYSDQKHMGSNDILKQRIL
KLTRDSLEYYLILQSESHRDAWTHVLILLLTKLLKLNEERFKYFSKGIYLLIGEIVVFDL
KAELRYILREFLLRIGRIYEINSD
Download sequence
Identical sequences GSADVT00055540001

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]